@base <http://purl.uniprot.org/uniprot/> .
@prefix annotation: <http://purl.uniprot.org/annotation/> .
@prefix citation: <http://purl.uniprot.org/citations/> .
@prefix dcterms: <http://purl.org/dc/terms/> .
@prefix disease: <http://purl.uniprot.org/diseases/> .
@prefix ECO: <http://purl.obolibrary.org/obo/ECO_> .
@prefix enzyme: <http://purl.uniprot.org/enzyme/> .
@prefix faldo: <http://biohackathon.org/resource/faldo#> .
@prefix foaf: <http://xmlns.com/foaf/0.1/> .
@prefix go: <http://purl.obolibrary.org/obo/GO_> .
@prefix isoform: <http://purl.uniprot.org/isoforms/> .
@prefix keyword: <http://purl.uniprot.org/keywords/> .
@prefix location: <http://purl.uniprot.org/locations/> .
@prefix owl: <http://www.w3.org/2002/07/owl#> .
@prefix position: <http://purl.uniprot.org/position/> .
@prefix pubmed: <http://purl.uniprot.org/pubmed/> .
@prefix range: <http://purl.uniprot.org/range/> .
@prefix rdf: <http://www.w3.org/1999/02/22-rdf-syntax-ns#> .
@prefix rdfs: <http://www.w3.org/2000/01/rdf-schema#> .
@prefix skos: <http://www.w3.org/2004/02/skos/core#> .
@prefix taxon: <http://purl.uniprot.org/taxonomy/> .
@prefix tissue: <http://purl.uniprot.org/tissues/> .
@prefix up: <http://purl.uniprot.org/core/> .
@prefix xsd: <http://www.w3.org/2001/XMLSchema#> .
<Q6Z6A4> rdf:type up:Protein ;
  up:reviewed false ;
  up:created "2004-07-05"^^xsd:date ;
  up:modified "2024-05-29"^^xsd:date ;
  up:version 113 ;
  up:mnemonic "Q6Z6A4_ORYSJ" ;
  up:citation citation:SIP9C9ABB6F33B5A79A ,
    citation:16100779 ,
    citation:23299411 ,
    citation:24280374 ,
    citation:SIPF49B513CA41FB848 ;
  rdfs:seeAlso <http://purl.uniprot.org/embl-cds/BAG87653.1> ,
    <http://purl.uniprot.org/embl-cds/BAS80972.1> ,
    <http://purl.uniprot.org/refseq/XP_015622731.1> ,
    <http://purl.uniprot.org/alphafolddb/Q6Z6A4> ,
    <http://purl.uniprot.org/smr/Q6Z6A4> ,
    <http://purl.uniprot.org/paxdb/39947-Q6Z6A4> ,
    <http://rdf.ebi.ac.uk/resource/ensembl.transcript/Os02t0754000-02> ,
    <http://purl.uniprot.org/geneid/4330761> ,
    <http://purl.uniprot.org/gramene/Os02t0754000-02> ,
    <http://purl.uniprot.org/kegg/osa:4330761> ,
    <http://purl.uniprot.org/eggnog/KOG2372> ,
    <http://purl.uniprot.org/hogenom/CLU_050634_1_0_1> ,
    <http://purl.uniprot.org/oma/FSCLHKN> ,
    <http://purl.orthodb.org/odbgroup/22641at2759> ,
    <http://purl.uniprot.org/expressionatlas/Q6Z6A4> ,
    <http://purl.uniprot.org/interpro/IPR006571> ,
    <http://purl.uniprot.org/panther/PTHR23354:SF62> ,
    <http://purl.uniprot.org/panther/PTHR23354> ,
    <http://purl.uniprot.org/pfam/PF07534> ,
    <http://purl.uniprot.org/smart/SM00584> ,
    <http://purl.uniprot.org/prosite/PS51886> ;
  up:recommendedName <Q6Z6A4#SIP0E46FEC46A5D8735> ;
  up:organism taxon:39947 ;
  up:encodedBy <Q6Z6A4#gene-MD5D8EC82004C8FEF7763886E769A717B68> ;
  up:annotation <Q6Z6A4#SIP376AFBF07B568B4D> ,
    <Q6Z6A4#SIP669B4E7969301513> ,
    <Q6Z6A4#SIP942C1BD4DFC97ECE> ,
    <Q6Z6A4#SIP05679E529341A0D7> ;
  up:existence up:Evidence_at_Transcript_Level_Existence ;
  up:classifiedWith keyword:1185 ,
    go:0005739 ,
    go:0005634 ,
    go:0006979 ;
  up:sequence isoform:Q6Z6A4-1 ;
  up:attribution <Q6Z6A4#attribution-0CACA73AD6FA5FC8FF131F2C26F5E326> ,
    <Q6Z6A4#attribution-879CE807735CB618FA1DA5EB695C5782> ,
    <Q6Z6A4#attribution-F9018CC563900EC7E81B2DCFAF2C985F> ,
    <Q6Z6A4#attribution-D269B8593A5F3B6EAF3AB0A3236CB0F4> ,
    <Q6Z6A4#attribution-6EC1470D4AB95D5CB071F00031E62CEB> ,
    <Q6Z6A4#attribution-260F9275F08C92D1CF2D41553CB78263> ,
    <Q6Z6A4#attribution-093DBF96122DE0449CC28AA2CE9AFAA0> ,
    <Q6Z6A4#attribution-CBBFD2E4A762E97A40111B1888CB2A9D> ,
    <Q6Z6A4#attribution-565356683A6A91E5051DB37895FB11C6> ,
    <Q6Z6A4#attribution-A32F665B48AA2227E5705DA2317910C4> ;
  up:proteome <http://purl.uniprot.org/proteomes/UP000059680#Chromosome%202> .
citation:SIP9C9ABB6F33B5A79A rdf:type up:Journal_Citation ;
  up:title "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from japonica Rice." ;
  up:author "Kikuchi S." ,
    "Satoh K." ,
    "Nagata T." ,
    "Kawagashira N." ,
    "Doi K." ,
    "Kishimoto N." ,
    "Yazaki J." ,
    "Ishikawa M." ,
    "Yamada H." ,
    "Ooka H." ,
    "Hotta I." ,
    "Kojima K." ,
    "Namiki T." ,
    "Ohneda E." ,
    "Yahagi W." ,
    "Suzuki K." ,
    "Li C." ,
    "Ohtsuki K." ,
    "Shishiki T." ,
    "Otomo Y." ,
    "Murakami K." ,
    "Iida Y." ,
    "Sugano S." ,
    "Fujimura T." ,
    "Suzuki Y." ,
    "Tsunoda Y." ,
    "Kurosaki T." ,
    "Kodama T." ,
    "Masuda H." ,
    "Kobayashi M." ,
    "Xie Q." ,
    "Lu M." ,
    "Narikawa R." ,
    "Sugiyama A." ,
    "Mizuno K." ,
    "Yokomizo S." ,
    "Niikura J." ,
    "Ikeda R." ,
    "Ishibiki J." ,
    "Kawamata M." ,
    "Yoshimura A." ,
    "Miura J." ,
    "Kusumegi T." ,
    "Oka M." ,
    "Ryu R." ,
    "Ueda M." ,
    "Matsubara K." ,
    "Kawai J." ,
    "Carninci P." ,
    "Adachi J." ,
    "Aizawa K." ,
    "Arakawa T." ,
    "Fukuda S." ,
    "Hara A." ,
    "Hashidume W." ,
    "Hayatsu N." ,
    "Imotani K." ,
    "Ishii Y." ,
    "Itoh M." ,
    "Kagawa I." ,
    "Kondo S." ,
    "Konno H." ,
    "Miyazaki A." ,
    "Osato N." ,
    "Ota Y." ,
    "Saito R." ,
    "Sasaki D." ,
    "Sato K." ,
    "Shibata K." ,
    "Shinagawa A." ,
    "Shiraki T." ,
    "Yoshino M." ,
    "Hayashizaki Y." ;
  up:date "2003"^^xsd:gYear ;
  up:name "Science" ;
  up:volume "301" ;
  up:pages "376-379" .
<#_Q6Z6A4-citation-SIP9C9ABB6F33B5A79A> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:citation ;
  rdf:object citation:SIP9C9ABB6F33B5A79A ;
  rdf:type up:Citation_Statement ;
  up:scope "NUCLEOTIDE SEQUENCE" ;
  up:attribution <Q6Z6A4#attribution-CBBFD2E4A762E97A40111B1888CB2A9D> .
citation:16100779 rdf:type up:Journal_Citation ;
  up:title "The map-based sequence of the rice genome." ;
  up:author "Matsumoto T." ,
    "Wu J." ,
    "Kanamori H." ,
    "Katayose Y." ,
    "Fujisawa M." ,
    "Namiki N." ,
    "Mizuno H." ,
    "Yamamoto K." ,
    "Antonio B.A." ,
    "Baba T." ,
    "Sakata K." ,
    "Nagamura Y." ,
    "Aoki H." ,
    "Arikawa K." ,
    "Arita K." ,
    "Bito T." ,
    "Chiden Y." ,
    "Fujitsuka N." ,
    "Fukunaka R." ,
    "Hamada M." ,
    "Harada C." ,
    "Hayashi A." ,
    "Hijishita S." ,
    "Honda M." ,
    "Hosokawa S." ,
    "Ichikawa Y." ,
    "Idonuma A." ,
    "Iijima M." ,
    "Ikeda M." ,
    "Ikeno M." ,
    "Ito K." ,
    "Ito S." ,
    "Ito T." ,
    "Ito Y." ,
    "Ito Y.'" ,
    "Iwabuchi A." ,
    "Kamiya K." ,
    "Karasawa W." ,
    "Kurita K." ,
    "Katagiri S." ,
    "Kikuta A." ,
    "Kobayashi H." ,
    "Kobayashi N." ,
    "Machita K." ,
    "Maehara T." ,
    "Masukawa M." ,
    "Mizubayashi T." ,
    "Mukai Y." ,
    "Nagasaki H." ,
    "Nagata Y." ,
    "Naito S." ,
    "Nakashima M." ,
    "Nakama Y." ,
    "Nakamichi Y." ,
    "Nakamura M." ,
    "Meguro A." ,
    "Negishi M." ,
    "Ohta I." ,
    "Ohta T." ,
    "Okamoto M." ,
    "Ono N." ,
    "Saji S." ,
    "Sakaguchi M." ,
    "Sakai K." ,
    "Shibata M." ,
    "Shimokawa T." ,
    "Song J." ,
    "Takazaki Y." ,
    "Terasawa K." ,
    "Tsugane M." ,
    "Tsuji K." ,
    "Ueda S." ,
    "Waki K." ,
    "Yamagata H." ,
    "Yamamoto M." ,
    "Yamamoto S." ,
    "Yamane H." ,
    "Yoshiki S." ,
    "Yoshihara R." ,
    "Yukawa K." ,
    "Zhong H." ,
    "Yano M." ,
    "Yuan Q." ,
    "Ouyang S." ,
    "Liu J." ,
    "Jones K.M." ,
    "Gansberger K." ,
    "Moffat K." ,
    "Hill J." ,
    "Bera J." ,
    "Fadrosh D." ,
    "Jin S." ,
    "Johri S." ,
    "Kim M." ,
    "Overton L." ,
    "Reardon M." ,
    "Tsitrin T." ,
    "Vuong H." ,
    "Weaver B." ,
    "Ciecko A." ,
    "Tallon L." ,
    "Jackson J." ,
    "Pai G." ,
    "Aken S.V." ,
    "Utterback T." ,
    "Reidmuller S." ,
    "Feldblyum T." ,
    "Hsiao J." ,
    "Zismann V." ,
    "Iobst S." ,
    "de Vazeille A.R." ,
    "Buell C.R." ,
    "Ying K." ,
    "Li Y." ,
    "Lu T." ,
    "Huang Y." ,
    "Zhao Q." ,
    "Feng Q." ,
    "Zhang L." ,
    "Zhu J." ,
    "Weng Q." ,
    "Mu J." ,
    "Lu Y." ,
    "Fan D." ,
    "Liu Y." ,
    "Guan J." ,
    "Zhang Y." ,
    "Yu S." ,
    "Liu X." ,
    "Zhang Y.'" ,
    "Hong G." ,
    "Han B." ,
    "Choisne N." ,
    "Demange N." ,
    "Orjeda G." ,
    "Samain S." ,
    "Cattolico L." ,
    "Pelletier E." ,
    "Couloux A." ,
    "Segurens B." ,
    "Wincker P." ,
    "D'Hont A." ,
    "Scarpelli C." ,
    "Weissenbach J." ,
    "Salanoubat M." ,
    "Quetier F." ,
    "Yu Y." ,
    "Kim H.R." ,
    "Rambo T." ,
    "Currie J." ,
    "Collura K." ,
    "Luo M." ,
    "Yang T." ,
    "Ammiraju J.S.S." ,
    "Engler F." ,
    "Soderlund C." ,
    "Wing R.A." ,
    "Palmer L.E." ,
    "de la Bastide M." ,
    "Spiegel L." ,
    "Nascimento L." ,
    "Zutavern T." ,
    "O'Shaughnessy A." ,
    "Dike S." ,
    "Dedhia N." ,
    "Preston R." ,
    "Balija V." ,
    "McCombie W.R." ,
    "Chow T." ,
    "Chen H." ,
    "Chung M." ,
    "Chen C." ,
    "Shaw J." ,
    "Wu H." ,
    "Hsiao K." ,
    "Chao Y." ,
    "Chu M." ,
    "Cheng C." ,
    "Hour A." ,
    "Lee P." ,
    "Lin S." ,
    "Lin Y." ,
    "Liou J." ,
    "Liu S." ,
    "Hsing Y." ,
    "Raghuvanshi S." ,
    "Mohanty A." ,
    "Bharti A.K." ,
    "Gaur A." ,
    "Gupta V." ,
    "Kumar D." ,
    "Ravi V." ,
    "Vij S." ,
    "Kapur A." ,
    "Khurana P." ,
    "Khurana P.'" ,
    "Khurana J.P." ,
    "Tyagi A.K." ,
    "Gaikwad K." ,
    "Singh A." ,
    "Dalal V." ,
    "Srivastava S." ,
    "Dixit A." ,
    "Pal A.K." ,
    "Ghazi I.A." ,
    "Yadav M." ,
    "Pandit A." ,
    "Bhargava A." ,
    "Sureshbabu K." ,
    "Batra K." ,
    "Sharma T.R." ,
    "Mohapatra T." ,
    "Singh N.K." ,
    "Messing J." ,
    "Nelson A.B." ,
    "Fuks G." ,
    "Kavchok S." ,
    "Keizer G." ,
    "Linton E." ,
    "Llaca V." ,
    "Song R." ,
    "Tanyolac B." ,
    "Young S." ,
    "Ho-Il K." ,
    "Hahn J.H." ,
    "Sangsakoo G." ,
    "Vanavichit A." ,
    "de Mattos Luiz.A.T." ,
    "Zimmer P.D." ,
    "Malone G." ,
    "Dellagostin O." ,
    "de Oliveira A.C." ,
    "Bevan M." ,
    "Bancroft I." ,
    "Minx P." ,
    "Cordum H." ,
    "Wilson R." ,
    "Cheng Z." ,
    "Jin W." ,
    "Jiang J." ,
    "Leong S.A." ,
    "Iwama H." ,
    "Gojobori T." ,
    "Itoh T." ,
    "Niimura Y." ,
    "Fujii Y." ,
    "Habara T." ,
    "Sakai H." ,
    "Sato Y." ,
    "Wilson G." ,
    "Kumar K." ,
    "McCouch S." ,
    "Juretic N." ,
    "Hoen D." ,
    "Wright S." ,
    "Bruskiewich R." ,
    "Bureau T." ,
    "Miyao A." ,
    "Hirochika H." ,
    "Nishikawa T." ,
    "Kadowaki K." ,
    "Sugiura M." ,
    "Burr B." ,
    "Sasaki T." ;
  up:group "International rice genome sequencing project (IRGSP)" ;
  skos:exactMatch pubmed:16100779 ;
  foaf:primaryTopicOf <https://pubmed.ncbi.nlm.nih.gov/16100779> ;
  dcterms:identifier "doi:10.1038/nature03895" ;
  up:date "2005"^^xsd:gYear ;
  up:name "Nature" ;
  up:volume "436" ;
  up:pages "793-800" .
<#_Q6Z6A4-citation-16100779> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:citation ;
  rdf:object citation:16100779 ;
  rdf:type up:Citation_Statement ;
  up:scope "NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]" ;
  up:context <Q6Z6A4#context-MD53038C70EDE4C8AF4AE3A7B887DA2412A> ;
  up:attribution <Q6Z6A4#attribution-A32F665B48AA2227E5705DA2317910C4> .
<Q6Z6A4#context-MD53038C70EDE4C8AF4AE3A7B887DA2412A> rdf:type up:Strain ;
  rdfs:label "cv. Nipponbare" .
<#_2E7DE865DB645979_up.context_BFFDAF03DF804B23> rdf:type rdf:Statement ;
  rdf:subject <#_Q6Z6A4-citation-16100779> ;
  rdf:predicate up:context ;
  rdf:object <Q6Z6A4#context-MD53038C70EDE4C8AF4AE3A7B887DA2412A> ;
  up:attribution <Q6Z6A4#attribution-A32F665B48AA2227E5705DA2317910C4> .
citation:23299411 rdf:type up:Journal_Citation ;
  up:title "Rice Annotation Project Database (RAP-DB): an integrative and interactive database for rice genomics." ;
  up:author "Sakai H." ,
    "Lee S.S." ,
    "Tanaka T." ,
    "Numa H." ,
    "Kim J." ,
    "Kawahara Y." ,
    "Wakimoto H." ,
    "Yang C.C." ,
    "Iwamoto M." ,
    "Abe T." ,
    "Yamada Y." ,
    "Muto A." ,
    "Inokuchi H." ,
    "Ikemura T." ,
    "Matsumoto T." ,
    "Sasaki T." ,
    "Itoh T." ;
  skos:exactMatch pubmed:23299411 ;
  foaf:primaryTopicOf <https://pubmed.ncbi.nlm.nih.gov/23299411> ;
  dcterms:identifier "doi:10.1093/pcp/pcs183" ;
  up:date "2013"^^xsd:gYear ;
  up:name "Plant Cell Physiol." ;
  up:volume "54" ;
  up:pages "E6" .
<#_Q6Z6A4-citation-23299411> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:citation ;
  rdf:object citation:23299411 ;
  rdf:type up:Citation_Statement ;
  up:scope "NUCLEOTIDE SEQUENCE" ;
  up:attribution <Q6Z6A4#attribution-565356683A6A91E5051DB37895FB11C6> .
citation:24280374 rdf:type up:Journal_Citation ;
  up:title "Improvement of the Oryza sativa Nipponbare reference genome using next generation sequence and optical map data." ;
  up:author "Kawahara Y." ,
    "de la Bastide M." ,
    "Hamilton J.P." ,
    "Kanamori H." ,
    "McCombie W.R." ,
    "Ouyang S." ,
    "Schwartz D.C." ,
    "Tanaka T." ,
    "Wu J." ,
    "Zhou S." ,
    "Childs K.L." ,
    "Davidson R.M." ,
    "Lin H." ,
    "Quesada-Ocampo L." ,
    "Vaillancourt B." ,
    "Sakai H." ,
    "Lee S.S." ,
    "Kim J." ,
    "Numa H." ,
    "Itoh T." ,
    "Buell C.R." ,
    "Matsumoto T." ;
  skos:exactMatch pubmed:24280374 ;
  foaf:primaryTopicOf <https://pubmed.ncbi.nlm.nih.gov/24280374> ;
  dcterms:identifier "doi:10.1186/1939-8433-6-4" ;
  up:date "2013"^^xsd:gYear ;
  up:name "Rice" ;
  up:volume "6" ;
  up:pages "4" .
<#_Q6Z6A4-citation-24280374> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:citation ;
  rdf:object citation:24280374 ;
  rdf:type up:Citation_Statement ;
  up:scope "NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]" ;
  up:context <Q6Z6A4#context-MD53038C70EDE4C8AF4AE3A7B887DA2412A> ;
  up:attribution <Q6Z6A4#attribution-565356683A6A91E5051DB37895FB11C6> ,
    <Q6Z6A4#attribution-A32F665B48AA2227E5705DA2317910C4> .
<#_1FE46E1D64E1A4F0_up.context_BFFDAF03DF804B23> rdf:type rdf:Statement ;
  rdf:subject <#_Q6Z6A4-citation-24280374> ;
  rdf:predicate up:context ;
  rdf:object <Q6Z6A4#context-MD53038C70EDE4C8AF4AE3A7B887DA2412A> ;
  up:attribution <Q6Z6A4#attribution-A32F665B48AA2227E5705DA2317910C4> .
citation:SIPF49B513CA41FB848 rdf:type up:Submission_Citation ;
  up:author "Sakai H." ,
    "Kawahara Y." ,
    "Matsumoto T." ,
    "Buell C.R." ,
    "Itoh T." ;
  up:date "2015-10"^^xsd:gYearMonth ;
  up:submittedTo "EMBL/GenBank/DDBJ" .
<#_Q6Z6A4-citation-SIPF49B513CA41FB848> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:citation ;
  rdf:object citation:SIPF49B513CA41FB848 ;
  rdf:type up:Citation_Statement ;
  up:scope "NUCLEOTIDE SEQUENCE" ;
  up:attribution <Q6Z6A4#attribution-565356683A6A91E5051DB37895FB11C6> .
<http://purl.uniprot.org/embl-cds/BAG87653.1> rdf:type up:Nucleotide_Resource ;
  up:database <http://purl.uniprot.org/database/EMBL> ;
  up:locatedOn <http://purl.uniprot.org/embl/AK060979> .
<http://purl.uniprot.org/embl/AK060979> rdf:type up:MRNA .
<http://purl.uniprot.org/embl-cds/BAS80972.1> rdf:type up:Nucleotide_Resource ;
  up:database <http://purl.uniprot.org/database/EMBL> ;
  up:locatedOn <http://purl.uniprot.org/embl/AP014958> .
<http://purl.uniprot.org/embl/AP014958> rdf:type up:Genomic_DNA .
<http://purl.uniprot.org/refseq/XP_015622731.1> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/RefSeq> ;
  up:translatedFrom <http://purl.uniprot.org/refseq/XM_015767245.1#XP_015622731.1_CDS> .
<http://purl.uniprot.org/refseq/XM_015767245.1#XP_015622731.1_CDS> up:locatedOn <http://purl.uniprot.org/refseq/XM_015767245.1> .
<http://purl.uniprot.org/alphafolddb/Q6Z6A4> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/AlphaFoldDB> .
<http://purl.uniprot.org/smr/Q6Z6A4> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/SMR> .
<http://purl.uniprot.org/paxdb/39947-Q6Z6A4> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/PaxDb> .
<http://rdf.ebi.ac.uk/resource/ensembl.transcript/Os02t0754000-02> rdf:type up:Transcript_Resource ;
  up:database <http://purl.uniprot.org/database/EnsemblPlants> ;
  up:translatedTo <http://rdf.ebi.ac.uk/resource/ensembl.protein/Os02t0754000-02> ;
  up:transcribedFrom <http://rdf.ebi.ac.uk/resource/ensembl/Os02g0754000> .
<http://purl.uniprot.org/geneid/4330761> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/GeneID> .
<http://purl.uniprot.org/gramene/Os02t0754000-02> rdf:type up:Transcript_Resource ;
  up:database <http://purl.uniprot.org/database/Gramene> ;
  up:translatedTo <http://purl.uniprot.org/gramene/Os02t0754000-02> ;
  up:transcribedFrom <http://purl.uniprot.org/gramene/Os02g0754000> .
<http://purl.uniprot.org/kegg/osa:4330761> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/KEGG> .
<http://purl.uniprot.org/eggnog/KOG2372> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/eggNOG> ;
  rdfs:comment "Eukaryota" .
<http://purl.uniprot.org/hogenom/CLU_050634_1_0_1> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/HOGENOM> .
<http://purl.uniprot.org/oma/FSCLHKN> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/OMA> .
<http://purl.orthodb.org/odbgroup/22641at2759> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/OrthoDB> .
<http://purl.uniprot.org/expressionatlas/Q6Z6A4> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/ExpressionAtlas> ;
  rdfs:comment "baseline and differential" .
<http://purl.uniprot.org/interpro/IPR006571> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/InterPro> ;
  rdfs:comment "TLDc_dom" .
<http://purl.uniprot.org/panther/PTHR23354:SF62> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/PANTHER> ;
  rdfs:comment "MUSTARD, ISOFORM V" ;
  up:signatureSequenceMatch <http://purl.uniprot.org/isoforms/Q6Z6A4-1#PANTHER_PTHR23354:SF62_match_1> .
<http://purl.uniprot.org/panther/PTHR23354> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/PANTHER> ;
  rdfs:comment "NUCLEOLAR PROTEIN 7/ESTROGEN RECEPTOR COACTIVATOR-RELATED" ;
  up:signatureSequenceMatch <http://purl.uniprot.org/isoforms/Q6Z6A4-1#PANTHER_PTHR23354_match_1> .
<http://purl.uniprot.org/pfam/PF07534> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/Pfam> ;
  rdfs:comment "TLD" ;
  up:signatureSequenceMatch <http://purl.uniprot.org/isoforms/Q6Z6A4-1#Pfam_PF07534_match_1> .
<http://purl.uniprot.org/smart/SM00584> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/SMART> ;
  rdfs:comment "TLDc" ;
  up:signatureSequenceMatch <http://purl.uniprot.org/isoforms/Q6Z6A4-1#SMART_SM00584_match_1> .
<http://purl.uniprot.org/prosite/PS51886> rdf:type up:Resource ;
  up:database <http://purl.uniprot.org/database/PROSITE> ;
  rdfs:comment "TLDC" ;
  up:signatureSequenceMatch <http://purl.uniprot.org/isoforms/Q6Z6A4-1#PROSITE_PS51886_match_1> .
<Q6Z6A4#SIP0E46FEC46A5D8735> rdf:type up:Structured_Name ;
  up:fullName "Oxidation resistance protein 1" .
<#_BFC36C143D9374AD_up.fullName_675DE041EB8865A1> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4#SIP0E46FEC46A5D8735> ;
  rdf:predicate up:fullName ;
  rdf:object "Oxidation resistance protein 1" ;
  up:attribution <Q6Z6A4#attribution-6EC1470D4AB95D5CB071F00031E62CEB> .
<#_kb.Q6Z6A4_up.organism_4B79A8A205701894> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:organism ;
  rdf:object taxon:39947 ;
  up:attribution <Q6Z6A4#attribution-565356683A6A91E5051DB37895FB11C6> ,
    <Q6Z6A4#attribution-A32F665B48AA2227E5705DA2317910C4> .
<Q6Z6A4#gene-MD5D8EC82004C8FEF7763886E769A717B68> rdf:type up:Gene ;
  up:locusName "Os02g0754000" ;
  up:orfName "OSNPB_020754000" .
<#_FBC78C5A95E2D11D_up.locusName_Os02g0754000> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4#gene-MD5D8EC82004C8FEF7763886E769A717B68> ;
  rdf:predicate up:locusName ;
  rdf:object "Os02g0754000" ;
  up:attribution <Q6Z6A4#attribution-565356683A6A91E5051DB37895FB11C6> .
<#_FBC78C5A95E2D11D_up.orfName_OSNPB_020754000> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4#gene-MD5D8EC82004C8FEF7763886E769A717B68> ;
  rdf:predicate up:orfName ;
  rdf:object "OSNPB_020754000" ;
  up:attribution <Q6Z6A4#attribution-565356683A6A91E5051DB37895FB11C6> .
<Q6Z6A4#SIP376AFBF07B568B4D> rdf:type up:Subcellular_Location_Annotation ;
  up:locatedIn <Q6Z6A4#SIPB41D4F3DFCB8C1B4> .
<Q6Z6A4#SIPB41D4F3DFCB8C1B4> up:cellularComponent location:173 .
<#_599654ED5A66658F_ECA11A063956BBD5_D086654D51A2A594> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4#SIPB41D4F3DFCB8C1B4> ;
  rdf:predicate up:cellularComponent ;
  rdf:object location:173 ;
  up:attribution <Q6Z6A4#attribution-F9018CC563900EC7E81B2DCFAF2C985F> .
<Q6Z6A4#SIP669B4E7969301513> rdf:type up:Similarity_Annotation ;
  rdfs:comment "Belongs to the OXR1 family." .
<#_AD1003CCD550DA2A_rdfs.comment_72EE11235AA10DD3> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4#SIP669B4E7969301513> ;
  rdf:predicate rdfs:comment ;
  rdf:object "Belongs to the OXR1 family." ;
  up:attribution <Q6Z6A4#attribution-D269B8593A5F3B6EAF3AB0A3236CB0F4> .
<Q6Z6A4#SIP942C1BD4DFC97ECE> rdf:type up:Domain_Extent_Annotation ;
  rdfs:comment "TLDc" ;
  up:range range:22859234198762542tt179tt342 .
range:22859234198762542tt179tt342 rdf:type faldo:Region ;
  faldo:begin position:22859234198762542tt179 ;
  faldo:end position:22859234198762542tt342 .
position:22859234198762542tt179 rdf:type faldo:Position ,
    faldo:ExactPosition ;
  faldo:position 179 ;
  faldo:reference isoform:Q6Z6A4-1 .
position:22859234198762542tt342 rdf:type faldo:Position ,
    faldo:ExactPosition ;
  faldo:position 342 ;
  faldo:reference isoform:Q6Z6A4-1 .
<#_kb.Q6Z6A4_up.annotation_926F7865B658ADE5> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:annotation ;
  rdf:object <Q6Z6A4#SIP942C1BD4DFC97ECE> ;
  up:attribution <Q6Z6A4#attribution-093DBF96122DE0449CC28AA2CE9AFAA0> .
<Q6Z6A4#SIP05679E529341A0D7> rdf:type up:Region_Annotation ;
  rdfs:comment "Disordered" ;
  up:range range:22859234198762542tt24tt64 .
range:22859234198762542tt24tt64 rdf:type faldo:Region ;
  faldo:begin position:22859234198762542tt24 ;
  faldo:end position:22859234198762542tt64 .
position:22859234198762542tt24 rdf:type faldo:Position ,
    faldo:ExactPosition ;
  faldo:position 24 ;
  faldo:reference isoform:Q6Z6A4-1 .
position:22859234198762542tt64 rdf:type faldo:Position ,
    faldo:ExactPosition ;
  faldo:position 64 ;
  faldo:reference isoform:Q6Z6A4-1 .
<#_kb.Q6Z6A4_up.annotation_07B6EE27A376D58D> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:annotation ;
  rdf:object <Q6Z6A4#SIP05679E529341A0D7> ;
  up:attribution <Q6Z6A4#attribution-260F9275F08C92D1CF2D41553CB78263> .
<#_kb.Q6Z6A4_up.classifiedWith_239F467843ABCFE3> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:classifiedWith ;
  rdf:object keyword:1185 ;
  up:attribution <Q6Z6A4#attribution-A32F665B48AA2227E5705DA2317910C4> .
<#_kb.Q6Z6A4_up.classifiedWith_obo.GO_0005739> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:classifiedWith ;
  rdf:object go:0005739 ;
  up:attribution <Q6Z6A4#attribution-0CACA73AD6FA5FC8FF131F2C26F5E326> .
<#_kb.Q6Z6A4_up.classifiedWith_obo.GO_0005634> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:classifiedWith ;
  rdf:object go:0005634 ;
  up:attribution <Q6Z6A4#attribution-879CE807735CB618FA1DA5EB695C5782> .
<#_kb.Q6Z6A4_up.classifiedWith_obo.GO_0006979> rdf:type rdf:Statement ;
  rdf:subject <Q6Z6A4> ;
  rdf:predicate up:classifiedWith ;
  rdf:object go:0006979 ;
  up:attribution <Q6Z6A4#attribution-879CE807735CB618FA1DA5EB695C5782> .
isoform:Q6Z6A4-1 rdf:type up:Simple_Sequence ;
  up:modified "2004-07-05"^^xsd:date ;
  up:version 1 ;
  up:mass 39633 ;
  up:md5Checksum "d25eb55593fc805729ff0b556a2100b3" ;
  rdf:value "MGYLPSSLGSKAAHFVSDLTTVILNPISEREPSSPLPEVDKDEEKSEDDKDSEQNSDTPDGPDTSSFRAFLISFLSSSGSSNGSMEIIPDQNGELGYPTLTPMGKSKKGKSGLLSRGKHSIGKIISKAARIGGFKQNVEPKIDREVVDHVESVSPVLELEESKEVASFINLPAMSEPSVLLSEVMRFNIYASFPVLAKGMNWVLLYSTWRHGISLSTLYRRSMLCPGYSLLVVGDKEGAVFGGLVEAPLQPTSAKKYQGSNSCFVFTNLHSNPSIYRPTGANNYFTVCSTDYLALGGGGHFALYLDADLLSGSSSNSETFNNMCLSHSPDFAVKDVELWGFVYPSKYDETLALCRTEKPGICRW" .
<Q6Z6A4#attribution-0CACA73AD6FA5FC8FF131F2C26F5E326> dcterms:creator <http://purl.uniprot.org/goa-projects/UniProtKB-SubCell> ;
  up:evidence ECO:0007669 .
<Q6Z6A4#attribution-879CE807735CB618FA1DA5EB695C5782> dcterms:creator <http://purl.uniprot.org/goa-projects/TreeGrafter> ;
  up:evidence ECO:0007669 .
<Q6Z6A4#attribution-F9018CC563900EC7E81B2DCFAF2C985F> up:evidence ECO:0000256 ;
  up:source <http://purl.uniprot.org/arba/ARBA00004173> .
<Q6Z6A4#attribution-D269B8593A5F3B6EAF3AB0A3236CB0F4> up:evidence ECO:0000256 ;
  up:source <http://purl.uniprot.org/arba/ARBA00009540> .
<Q6Z6A4#attribution-6EC1470D4AB95D5CB071F00031E62CEB> up:evidence ECO:0000256 ;
  up:source <http://purl.uniprot.org/arba/ARBA00040604> .
<Q6Z6A4#attribution-260F9275F08C92D1CF2D41553CB78263> up:evidence ECO:0000256 ;
  up:source <http://purl.uniprot.org/sam/MobiDB-lite> .
<Q6Z6A4#attribution-093DBF96122DE0449CC28AA2CE9AFAA0> up:evidence ECO:0000259 ;
  up:source <http://purl.uniprot.org/prosite/PS51886> .
<Q6Z6A4#attribution-CBBFD2E4A762E97A40111B1888CB2A9D> up:evidence ECO:0000313 ;
  up:source <http://purl.uniprot.org/embl-cds/BAG87653.1> .
<Q6Z6A4#attribution-565356683A6A91E5051DB37895FB11C6> up:evidence ECO:0000313 ;
  up:source <http://purl.uniprot.org/embl-cds/BAS80972.1> .
<Q6Z6A4#attribution-A32F665B48AA2227E5705DA2317910C4> up:evidence ECO:0000313 ;
  up:source <http://purl.uniprot.org/proteomes/UP000059680> .