@base .
@prefix annotation: .
@prefix citation: .
@prefix dcterms: .
@prefix disease: .
@prefix ECO: .
@prefix enzyme: .
@prefix faldo: .
@prefix foaf: .
@prefix go: .
@prefix isoform: .
@prefix keyword: .
@prefix location: .
@prefix owl: .
@prefix position: .
@prefix pubmed: .
@prefix range: .
@prefix rdf: .
@prefix rdfs: .
@prefix skos: .
@prefix taxon: .
@prefix tissue: .
@prefix up: .
@prefix xsd: .
rdf:type up:Protein ;
up:reviewed false ;
up:created "2013-07-24"^^xsd:date ;
up:modified "2024-01-24"^^xsd:date ;
up:version 24 ;
up:mnemonic "R7EFX9_BACUN" ;
up:citation citation:SIP64BA6E900C256401 ;
rdfs:seeAlso ,
,
,
;
up:recommendedName ;
up:organism taxon:1263055 ;
up:encodedBy ;
up:annotation ;
up:existence up:Predicted_Existence ;
up:sequence isoform:R7EFX9-1 ;
up:attribution ,
,
;
up:proteome .
citation:SIP64BA6E900C256401 rdf:type up:Submission_Citation ;
up:title "Dependencies among metagenomic species, viruses, plasmids and units of genetic variation." ;
up:author "Nielsen H.B." ,
"Almeida M." ,
"Juncker A.S." ,
"Rasmussen S." ,
"Li J." ,
"Sunagawa S." ,
"Plichta D." ,
"Gautier L." ,
"Le Chatelier E." ,
"Peletier E." ,
"Bonde I." ,
"Nielsen T." ,
"Manichanh C." ,
"Arumugam M." ,
"Batto J." ,
"Santos M.B.Q.D." ,
"Blom N." ,
"Borruel N." ,
"Burgdorf K.S." ,
"Boumezbeur F." ,
"Casellas F." ,
"Dore J." ,
"Guarner F." ,
"Hansen T." ,
"Hildebrand F." ,
"Kaas R.S." ,
"Kennedy S." ,
"Kristiansen K." ,
"Kultima J.R." ,
"Leonard P." ,
"Levenez F." ,
"Lund O." ,
"Moumen B." ,
"Le Paslier D." ,
"Pons N." ,
"Pedersen O." ,
"Prifti E." ,
"Qin J." ,
"Raes J." ,
"Tap J." ,
"Tims S." ,
"Ussery D.W." ,
"Yamada T." ,
"MetaHit consortium" ,
"Renault P." ,
"Sicheritz-Ponten T." ,
"Bork P." ,
"Wang J." ,
"Brunak S." ,
"Ehrlich S.D." ;
up:date "2012-11"^^xsd:gYearMonth ;
up:submittedTo "EMBL/GenBank/DDBJ" .
<#_R7EFX9-citation-SIP64BA6E900C256401> rdf:type rdf:Statement ;
rdf:subject ;
rdf:predicate up:citation ;
rdf:object citation:SIP64BA6E900C256401 ;
rdf:type up:Citation_Statement ;
up:scope "NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]" ;
up:attribution .
rdf:type up:Nucleotide_Resource ;
up:database ;
up:locatedOn .
rdf:type up:Genomic_DNA .
rdf:type up:Resource ;
up:database .
rdf:type up:Resource ;
up:database ;
rdfs:comment "DUF3226" .
rdf:type up:Resource ;
up:database ;
rdfs:comment "DUF3226" ;
up:signatureSequenceMatch .
rdf:type up:Structured_Name ;
up:fullName "DUF4435 domain-containing protein" .
<#_3D0A9D88C510DBFF_up.fullName_1DFBFB40826162E6> rdf:type rdf:Statement ;
rdf:subject ;
rdf:predicate up:fullName ;
rdf:object "DUF4435 domain-containing protein" ;
up:attribution .
<#_kb.R7EFX9_up.organism_EFC71065EF2B4B63> rdf:type rdf:Statement ;
rdf:subject ;
rdf:predicate up:organism ;
rdf:object taxon:1263055 ;
up:attribution ,
.
rdf:type up:Gene ;
up:orfName "BN594_02421" .
<#_75EF31BAD8F17F04_up.orfName_BN594_02421> rdf:type rdf:Statement ;
rdf:subject ;
rdf:predicate up:orfName ;
rdf:object "BN594_02421" ;
up:attribution .
rdf:type up:Caution_Annotation ;
rdfs:comment "The sequence shown here is derived from an EMBL/GenBank/DDBJ whole genome shotgun (WGS) entry which is preliminary data." .
<#_DBE3630DF7432A3A_rdfs.comment_38383351B32BC570> rdf:type rdf:Statement ;
rdf:subject ;
rdf:predicate rdfs:comment ;
rdf:object "The sequence shown here is derived from an EMBL/GenBank/DDBJ whole genome shotgun (WGS) entry which is preliminary data." ;
up:attribution .
isoform:R7EFX9-1 rdf:type up:Simple_Sequence ;
up:modified "2013-07-24"^^xsd:date ;
up:version 1 ;
up:mass 24376 ;
up:md5Checksum "c0baeaebcfaf0f501a0d2246d4bfa9f4" ;
rdf:value "MSKLSKSLPYHLFVEGKNDLHVVSSLCGLHHVNQNFNIKVCESVENAIGLFRLTLTNPSAYPRIGVVLDADTDVEKRWRQLVDILKSSNKYDCDGLDLPSDGLVLYPLNDYDAVVGIWIMPNNRFEGMLEDFALNMIPAEDLLIRKVEVVLSELEAEGIQRYKQVHRSKAKIHTFLAWQDEPGKPIGQAITARILNPDAEEAKAFIGWLNKLYDR" .
up:evidence ECO:0000313 ;
up:source .
up:evidence ECO:0000313 ;
up:source .
up:evidence ECO:0008006 ;
up:source .