Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 184 (31 Jul 2019)
Sequence version 3 (29 Mar 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Gene

ASAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2
Alternative name(s):
Development and differentiation-enhancing factor 2
Paxillin-associated protein with ARF GAP activity 3
Short name:
PAG3
Pyk2 C-terminus-associated protein
Short name:
PAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ASAP2
Synonyms:DDEF2, KIAA0400
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2721 ASAP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603817 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O43150

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi436C → A: Loss of Arf-GAP activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
8853

Open Targets

More...
OpenTargetsi
ENSG00000151693

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164716118

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ASAP2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000741981 – 1006Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2Add BLAST1006

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei701PhosphoserineCombined sources1
Modified residuei822PhosphoserineCombined sources1
Modified residuei903PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine residues by SRC and PTK2B.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O43150

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O43150

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O43150

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O43150

PeptideAtlas

More...
PeptideAtlasi
O43150

PRoteomics IDEntifications database

More...
PRIDEi
O43150

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48770 [O43150-1]
48771 [O43150-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O43150

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O43150

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in heart, brain, placenta, kidney, monocytes and pancreas.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated during monocytic maturation.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000151693 Expressed in 232 organ(s), highest expression level in forebrain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O43150 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O43150 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB018615

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds PXN, ARF1, ARF5, ARF6, PTK2B and SRC.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114378, 21 interactors

Protein interaction database and analysis system

More...
IntActi
O43150, 19 interactors

Molecular INTeraction database

More...
MINTi
O43150

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000281419

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O43150

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini305 – 397PHPROSITE-ProRule annotationAdd BLAST93
Domaini421 – 543Arf-GAPPROSITE-ProRule annotationAdd BLAST123
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati584 – 616ANK 1Add BLAST33
Repeati620 – 649ANK 2Add BLAST30
Domaini944 – 1006SH3PROSITE-ProRule annotationAdd BLAST63

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili256 – 283Sequence analysisAdd BLAST28
Coiled coili729 – 752Sequence analysisAdd BLAST24

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi771 – 936Pro-richAdd BLAST166

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The conserved Arg-464 in the Arf-GAP domain probably becomes part of the active site of bound small GTPases and is necessary for GTP hydrolysis.

Keywords - Domaini

ANK repeat, Coiled coil, Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0521 Eukaryota
COG5347 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155623

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230570

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O43150

KEGG Orthology (KO)

More...
KOi
K12488

Identification of Orthologs from Complete Genome Data

More...
OMAi
VKAIYTS

Database of Orthologous Groups

More...
OrthoDBi
751525at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O43150

TreeFam database of animal gene trees

More...
TreeFami
TF325156

Family and domain databases

Conserved Domains Database

More...
CDDi
cd13251 PH_ASAP, 1 hit
cd11966 SH3_ASAP2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1270.60, 1 hit
1.25.40.20, 1 hit
2.30.29.30, 1 hit
3.30.40.160, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
IPR035677 ASAP2_SH3
IPR011993 PH-like_dom_sf
IPR037844 PH_ASAP
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 1 hit
PF01412 ArfGap, 1 hit
PF00169 PH, 1 hit
PF14604 SH3_9, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00405 REVINTRACTNG

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 3 hits
SM00105 ArfGap, 1 hit
SM00233 PH, 1 hit
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103657 SSF103657, 1 hit
SSF48403 SSF48403, 1 hit
SSF50044 SSF50044, 1 hit
SSF57863 SSF57863, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 1 hit
PS50115 ARFGAP, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O43150-1) [UniParc]FASTAAdd to basket
Also known as: PAPalpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPDQISVSEF VAETHEDYKA PTASSFTTRT AQCRNTVAAI EEALDVDRMV
60 70 80 90 100
LYKMKKSVKA INSSGLAHVE NEEQYTQALE KFGGNCVCRD DPDLGSAFLK
110 120 130 140 150
FSVFTKELTA LFKNLIQNMN NIISFPLDSL LKGDLKGVKG DLKKPFDKAW
160 170 180 190 200
KDYETKITKI EKEKKEHAKL HGMIRTEISG AEIAEEMEKE RRFFQLQMCE
210 220 230 240 250
YLLKVNEIKI KKGVDLLQNL IKYFHAQCNF FQDGLKAVES LKPSIETLST
260 270 280 290 300
DLHTIKQAQD EERRQLIQLR DILKSALQVE QKEDSQIRQS TAYSLHQPQG
310 320 330 340 350
NKEHGTERNG SLYKKSDGIR KVWQKRKCSV KNGFLTISHG TANRPPAKLN
360 370 380 390 400
LLTCQVKTNP EEKKCFDLIS HDRTYHFQAE DEQECQIWMS VLQNSKEEAL
410 420 430 440 450
NNAFKGDDNT GENNIVQELT KEIISEVQRM TGNDVCCDCG APDPTWLSTN
460 470 480 490 500
LGILTCIECS GIHRELGVHY SRMQSLTLDV LGTSELLLAK NIGNAGFNEI
510 520 530 540 550
MECCLPAEDS VKPNPGSDMN ARKDYITAKY IERRYARKKH ADNAAKLHSL
560 570 580 590 600
CEAVKTRDIF GLLQAYADGV DLTEKIPLAN GHEPDETALH LAVRSVDRTS
610 620 630 640 650
LHIVDFLVQN SGNLDKQTGK GSTALHYCCL TDNAECLKLL LRGKASIEIA
660 670 680 690 700
NESGETPLDI AKRLKHEHCE ELLTQALSGR FNSHVHVEYE WRLLHEDLDE
710 720 730 740 750
SDDDMDEKLQ PSPNRREDRP ISFYQLGSNQ LQSNAVSLAR DAANLAKEKQ
760 770 780 790 800
RAFMPSILQN ETYGALLSGS PPPAQPAAPS TTSAPPLPPR NVGKVQTASS
810 820 830 840 850
ANTLWKTNSV SVDGGSRQRS SSDPPAVHPP LPPLRVTSTN PLTPTPPPPV
860 870 880 890 900
AKTPSVMEAL SQPSKPAPPG ISQIRPPPLP PQPPSRLPQK KPAPGADKST
910 920 930 940 950
PLTNKGQPRG PVDLSATEAL GPLSNAMVLQ PPAPMPRKSQ ATKLKPKRVK
960 970 980 990 1000
ALYNCVADNP DELTFSEGDV IIVDGEEDQE WWIGHIDGDP GRKGAFPVSF

VHFIAD
Length:1,006
Mass (Da):111,651
Last modified:March 29, 2004 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6A213517DCD99E1B
GO
Isoform 2 (identifier: O43150-2) [UniParc]FASTAAdd to basket
Also known as: PAPbeta

The sequence of this isoform differs from the canonical sequence as follows:
     795-840: VQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN → D

Show »
Length:961
Mass (Da):106,982
Checksum:i7C8DF5590A4FB792
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A286YFG8A0A286YFG8_HUMAN
Arf-GAP with SH3 domain, ANK repeat...
ASAP2
317Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA23696 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti86C → R in AAH63308 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_020307748E → D1 PublicationCorresponds to variant dbSNP:rs2715860Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_009722795 – 840VQTAS…VTSTN → D in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB007860 mRNA Translation: BAA23696.2 Different initiation.
CH471053 Genomic DNA Translation: EAX01004.1
CH471053 Genomic DNA Translation: EAX01006.1
BC063308 mRNA Translation: AAH63308.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1661.1 [O43150-1]
CCDS46224.1 [O43150-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00050

NCBI Reference Sequences

More...
RefSeqi
NP_001128663.1, NM_001135191.1 [O43150-2]
NP_003878.1, NM_003887.2 [O43150-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000281419; ENSP00000281419; ENSG00000151693 [O43150-1]
ENST00000315273; ENSP00000316404; ENSG00000151693 [O43150-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8853

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8853

UCSC genome browser

More...
UCSCi
uc002qzh.3 human [O43150-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007860 mRNA Translation: BAA23696.2 Different initiation.
CH471053 Genomic DNA Translation: EAX01004.1
CH471053 Genomic DNA Translation: EAX01006.1
BC063308 mRNA Translation: AAH63308.1
CCDSiCCDS1661.1 [O43150-1]
CCDS46224.1 [O43150-2]
PIRiT00050
RefSeqiNP_001128663.1, NM_001135191.1 [O43150-2]
NP_003878.1, NM_003887.2 [O43150-1]

3D structure databases

SMRiO43150
ModBaseiSearch...

Protein-protein interaction databases

BioGridi114378, 21 interactors
IntActiO43150, 19 interactors
MINTiO43150
STRINGi9606.ENSP00000281419

PTM databases

iPTMnetiO43150
PhosphoSitePlusiO43150

Polymorphism and mutation databases

BioMutaiASAP2

Proteomic databases

EPDiO43150
jPOSTiO43150
MaxQBiO43150
PaxDbiO43150
PeptideAtlasiO43150
PRIDEiO43150
ProteomicsDBi48770 [O43150-1]
48771 [O43150-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000281419; ENSP00000281419; ENSG00000151693 [O43150-1]
ENST00000315273; ENSP00000316404; ENSG00000151693 [O43150-2]
GeneIDi8853
KEGGihsa:8853
UCSCiuc002qzh.3 human [O43150-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8853
DisGeNETi8853

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ASAP2
HGNCiHGNC:2721 ASAP2
HPAiCAB018615
MIMi603817 gene
neXtProtiNX_O43150
OpenTargetsiENSG00000151693
PharmGKBiPA164716118

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0521 Eukaryota
COG5347 LUCA
GeneTreeiENSGT00940000155623
HOGENOMiHOG000230570
InParanoidiO43150
KOiK12488
OMAiVKAIYTS
OrthoDBi751525at2759
PhylomeDBiO43150
TreeFamiTF325156

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ASAP2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DDEF2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8853

Protein Ontology

More...
PROi
PR:O43150

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000151693 Expressed in 232 organ(s), highest expression level in forebrain
ExpressionAtlasiO43150 baseline and differential
GenevisibleiO43150 HS

Family and domain databases

CDDicd13251 PH_ASAP, 1 hit
cd11966 SH3_ASAP2, 1 hit
Gene3Di1.20.1270.60, 1 hit
1.25.40.20, 1 hit
2.30.29.30, 1 hit
3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
IPR035677 ASAP2_SH3
IPR011993 PH-like_dom_sf
IPR037844 PH_ASAP
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF01412 ArfGap, 1 hit
PF00169 PH, 1 hit
PF14604 SH3_9, 1 hit
PRINTSiPR00405 REVINTRACTNG
SMARTiView protein in SMART
SM00248 ANK, 3 hits
SM00105 ArfGap, 1 hit
SM00233 PH, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF48403 SSF48403, 1 hit
SSF50044 SSF50044, 1 hit
SSF57863 SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 1 hit
PS50115 ARFGAP, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiASAP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43150
Secondary accession number(s): D6W4Y8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 29, 2004
Last modified: July 31, 2019
This is version 184 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again