Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (16 Oct 2019)
Sequence version 1 (01 May 1999)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Myelin protein zero-like protein 1

Gene

MPZL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell surface receptor, which is involved in signal transduction processes. Recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. Is a major receptor for concanavalin-A (ConA) and is involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases. Isoform 3 seems to have a dominant negative role; it blocks tyrosine phosphorylation of MPZL1 induced by ConA. Isoform 1, but not isoform 2 and isoform 3, may be involved in regulation of integrin-mediated cell motility.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • structural molecule activity Source: ProtInc

GO - Biological processi

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O95297

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O95297

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myelin protein zero-like protein 1
Alternative name(s):
Protein zero-related
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MPZL1
Synonyms:PZR1 Publication
ORF Names:UNQ849/PRO1787
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7226 MPZL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604376 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95297

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini36 – 162ExtracellularSequence analysisAdd BLAST127
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei163 – 183HelicalSequence analysisAdd BLAST21
Topological domaini184 – 269CytoplasmicSequence analysisAdd BLAST86

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi241Y → F: Significantly decreases phosphorylation. Complete loss of phosphorylation; when associated with F-263. 1 Publication1
Mutagenesisi263Y → F: Significantly decreases phosphorylation. Complete loss of phosphorylation; when associated with F-241. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
9019

Open Targets

More...
OpenTargetsi
ENSG00000197965

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30931

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O95297

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MPZL1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 35Sequence analysisAdd BLAST35
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000024033536 – 269Myelin protein zero-like protein 1Add BLAST234

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi50N-linked (GlcNAc...) asparagine2 Publications1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi58 ↔ 135PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi130N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei204PhosphoserineCombined sources1
Modified residuei206PhosphoserineCombined sources1
Modified residuei208PhosphoserineCombined sources1
Modified residuei210PhosphoserineCombined sources1
Modified residuei219PhosphoserineCombined sources1
Modified residuei221PhosphoserineCombined sources1
Modified residuei241PhosphotyrosineCombined sources1 Publication1
Modified residuei260PhosphoserineCombined sources1
Modified residuei263PhosphotyrosineCombined sources1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine residues upon stimulation with pervanadate and concanavalin-A (ConA). Phosphorylation at Tyr-241 and Tyr-263 is required for interaction with PTPN11/SHP-2. Dephosphorylated by PTPN11/SHP-2 (in vitro).3 Publications
N-glycosylated. N-glycosylation is required for concanavalin A binding (PubMed:30392906).4 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95297

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95297

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O95297

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95297

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95297

PeptideAtlas

More...
PeptideAtlasi
O95297

PRoteomics IDEntifications database

More...
PRIDEi
O95297

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
50793 [O95297-1]
50794 [O95297-2]
50795 [O95297-3]
50796 [O95297-4]
50797 [O95297-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O95297-1 [O95297-1]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1527

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95297

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95297

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in heart, placenta, kidney and pancreas. Isoform 3 is relatively abundant in hematopoietic tissues and fetal liver. Isoform 1 and isoform 3 are expressed in CD14- PB monocytes and pre-B cell progenitors. Isoform 3 appears to be the major isoform in CD34- promyelocytic and promonocytic cells. During differentiation in monocytic cells, the expression level of isoform 3 decreases and that of isoform 1 increases. Isoform 1 is prominent in stromal cells and, to a lesser extent, in umbilical vein endothelial cells and erythroid progenitors. Isoform 2 is expressed in a erythroid progenitor cell line.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000197965 Expressed in 219 organ(s), highest expression level in urinary bladder

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95297 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95297 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA026966
HPA063538

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with phosphorylated PTPN11/SHP-2.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q061244EBI-963338,EBI-297779

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114486, 66 interactors

Protein interaction database and analysis system

More...
IntActi
O95297, 53 interactors

Molecular INTeraction database

More...
MINTi
O95297

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000352513

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1269
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95297

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini36 – 146Ig-like V-typeAdd BLAST111

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi239 – 244ITIM motif 16
Motifi261 – 266ITIM motif 26

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the myelin P0 protein family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVXC Eukaryota
ENOG4111MDZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182726

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000059672

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95297

KEGG Orthology (KO)

More...
KOi
K06770

Identification of Orthologs from Complete Genome Data

More...
OMAi
RISFFYY

Database of Orthologous Groups

More...
OrthoDBi
1440680at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95297

TreeFam database of animal gene trees

More...
TreeFami
TF331728

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR029870 MPZL1
IPR000920 Myelin_P0-rel

The PANTHER Classification System

More...
PANTHERi
PTHR13869 PTHR13869, 1 hit
PTHR13869:SF19 PTHR13869:SF19, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07686 V-set, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00213 MYELINP0

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95297-1) [UniParc]FASTAAdd to basket
Also known as: MPZL1a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAASAGAGAV IAAPDSRRWL WSVLAAALGL LTAGVSALEV YTPKEIFVAN
60 70 80 90 100
GTQGKLTCKF KSTSTTGGLT SVSWSFQPEG ADTTVSFFHY SQGQVYLGNY
110 120 130 140 150
PPFKDRISWA GDLDKKDASI NIENMQFIHN GTYICDVKNP PDIVVQPGHI
160 170 180 190 200
RLYVVEKENL PVFPVWVVVG IVTAVVLGLT LLISMILAVL YRRKNSKRDY
210 220 230 240 250
TGCSTSESLS PVKQAPRKSP SDTEGLVKSL PSGSHQGPVI YAQLDHSGGH
260
HSDKINKSES VVYADIRKN
Length:269
Mass (Da):29,082
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA1B299041EE59425
GO
Isoform 2 (identifier: O95297-2) [UniParc]FASTAAdd to basket
Also known as: PZR1a

The sequence of this isoform differs from the canonical sequence as follows:
     42-42: Missing.

Show »
Length:268
Mass (Da):28,981
Checksum:iC696D8EE3C297715
GO
Isoform 3 (identifier: O95297-3) [UniParc]FASTAAdd to basket
Also known as: PZR1b

The sequence of this isoform differs from the canonical sequence as follows:
     203-269: CSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN → AQSYMHS

Show »
Length:209
Mass (Da):22,761
Checksum:i18EC385959C88329
GO
Isoform 4 (identifier: O95297-4) [UniParc]FASTAAdd to basket
Also known as: MPZL1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-124: Missing.

Show »
Length:145
Mass (Da):15,947
Checksum:i64F88C2B041B87F8
GO
Isoform 5 (identifier: O95297-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-236: Missing.

Note: No experimental confirmation available.
Show »
Length:119
Mass (Da):12,354
Checksum:i56BDFA661BA6A9EB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WFC4F8WFC4_HUMAN
Myelin protein zero-like protein 1
MPZL1
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q9UEL6Q9UEL6_HUMAN
Myelin protein zero-like protein 1
MPZL1
183Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti42T → A in AAO14646 (PubMed:12410637).Curated1
Sequence conflicti177L → I in AAO14646 (PubMed:12410637).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0193421 – 124Missing in isoform 4. 1 PublicationAdd BLAST124
Alternative sequenceiVSP_01934342Missing in isoform 2. Curated1
Alternative sequenceiVSP_04334187 – 236Missing in isoform 5. 1 PublicationAdd BLAST150
Alternative sequenceiVSP_019344203 – 269CSTSE…DIRKN → AQSYMHS in isoform 3. 2 PublicationsAdd BLAST67

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF087020 mRNA Translation: AAC72231.1
AF092424 mRNA Translation: AAD55346.1
AF092425 mRNA Translation: AAD55347.1
AF095726 mRNA Translation: AAF00083.1
AF095727 mRNA Translation: AAF00084.1
AF239756 mRNA Translation: AAF63499.1
AF478447 mRNA Translation: AAO14645.1
AF478448 Genomic DNA Translation: AAO14647.1
AF478448 Genomic DNA Translation: AAO14646.1
AY359019 mRNA Translation: AAQ89378.1
AK297112 mRNA Translation: BAH12501.1
CR542160 mRNA Translation: CAG46957.1
AL356532 Genomic DNA No translation available.
Z99943 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90800.1
BC007881 mRNA Translation: AAH07881.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1264.1 [O95297-1]
CCDS44273.1 [O95297-3]
CCDS53425.1 [O95297-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001139663.1, NM_001146191.1 [O95297-5]
NP_003944.1, NM_003953.5 [O95297-1]
NP_078845.3, NM_024569.4 [O95297-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000359523; ENSP00000352513; ENSG00000197965 [O95297-1]
ENST00000392121; ENSP00000375968; ENSG00000197965 [O95297-5]
ENST00000474859; ENSP00000420455; ENSG00000197965 [O95297-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9019

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9019

UCSC genome browser

More...
UCSCi
uc001geo.3 human [O95297-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087020 mRNA Translation: AAC72231.1
AF092424 mRNA Translation: AAD55346.1
AF092425 mRNA Translation: AAD55347.1
AF095726 mRNA Translation: AAF00083.1
AF095727 mRNA Translation: AAF00084.1
AF239756 mRNA Translation: AAF63499.1
AF478447 mRNA Translation: AAO14645.1
AF478448 Genomic DNA Translation: AAO14647.1
AF478448 Genomic DNA Translation: AAO14646.1
AY359019 mRNA Translation: AAQ89378.1
AK297112 mRNA Translation: BAH12501.1
CR542160 mRNA Translation: CAG46957.1
AL356532 Genomic DNA No translation available.
Z99943 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90800.1
BC007881 mRNA Translation: AAH07881.1
CCDSiCCDS1264.1 [O95297-1]
CCDS44273.1 [O95297-3]
CCDS53425.1 [O95297-5]
RefSeqiNP_001139663.1, NM_001146191.1 [O95297-5]
NP_003944.1, NM_003953.5 [O95297-1]
NP_078845.3, NM_024569.4 [O95297-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6IGOX-ray2.75A/B/C/D/E/F36-162[»]
6IGTX-ray2.40A/B/C/D36-162[»]
6IGWX-ray1.98A36-162[»]
SMRiO95297
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi114486, 66 interactors
IntActiO95297, 53 interactors
MINTiO95297
STRINGi9606.ENSP00000352513

PTM databases

GlyConnecti1527
iPTMnetiO95297
PhosphoSitePlusiO95297

Polymorphism and mutation databases

BioMutaiMPZL1

Proteomic databases

EPDiO95297
jPOSTiO95297
MassIVEiO95297
MaxQBiO95297
PaxDbiO95297
PeptideAtlasiO95297
PRIDEiO95297
ProteomicsDBi50793 [O95297-1]
50794 [O95297-2]
50795 [O95297-3]
50796 [O95297-4]
50797 [O95297-5]
TopDownProteomicsiO95297-1 [O95297-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9019

Genome annotation databases

EnsembliENST00000359523; ENSP00000352513; ENSG00000197965 [O95297-1]
ENST00000392121; ENSP00000375968; ENSG00000197965 [O95297-5]
ENST00000474859; ENSP00000420455; ENSG00000197965 [O95297-3]
GeneIDi9019
KEGGihsa:9019
UCSCiuc001geo.3 human [O95297-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9019
DisGeNETi9019

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MPZL1
HGNCiHGNC:7226 MPZL1
HPAiHPA026966
HPA063538
MIMi604376 gene
neXtProtiNX_O95297
OpenTargetsiENSG00000197965
PharmGKBiPA30931

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVXC Eukaryota
ENOG4111MDZ LUCA
GeneTreeiENSGT00950000182726
HOGENOMiHOG000059672
InParanoidiO95297
KOiK06770
OMAiRISFFYY
OrthoDBi1440680at2759
PhylomeDBiO95297
TreeFamiTF331728

Enzyme and pathway databases

SignaLinkiO95297
SIGNORiO95297

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MPZL1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MPZL1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9019
PharosiO95297

Protein Ontology

More...
PROi
PR:O95297

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000197965 Expressed in 219 organ(s), highest expression level in urinary bladder
ExpressionAtlasiO95297 baseline and differential
GenevisibleiO95297 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR029870 MPZL1
IPR000920 Myelin_P0-rel
PANTHERiPTHR13869 PTHR13869, 1 hit
PTHR13869:SF19 PTHR13869:SF19, 1 hit
PfamiView protein in Pfam
PF07686 V-set, 1 hit
PRINTSiPR00213 MYELINP0
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMPZL1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95297
Secondary accession number(s): B2REB9
, B2REC0, Q5R332, Q8IX11, Q9BWZ3, Q9NYK4, Q9UL20
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: May 1, 1999
Last modified: October 16, 2019
This is version 169 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again