Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 192 (18 Sep 2019)
Sequence version 1 (01 Jul 1989)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

T-cell surface glycoprotein CD8 beta chain

Gene

CD8B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. A palmitoylation site in the cytoplasmic tail of CD8B chain contributes to partitioning of CD8 into the plasma membrane lipid rafts where signaling proteins are enriched. Once LCK recruited, it initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). Additionally, plays a critical role in thymic selection of CD8+ T-cells.By similarity3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • coreceptor activity Source: UniProtKB
  • MHC class I protein binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-182218 Nef Mediated CD8 Down-regulation
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
T-cell surface glycoprotein CD8 beta chain
Alternative name(s):
CD_antigen: CD8b
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CD8B
Synonyms:CD8B1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1707 CD8B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
186730 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P10966

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini22 – 170ExtracellularSequence analysisAdd BLAST149
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei171 – 191HelicalSequence analysisAdd BLAST21
Topological domaini192 – 210CytoplasmicSequence analysisAdd BLAST19

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
926

Open Targets

More...
OpenTargetsi
ENSG00000172116

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26245

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CD8B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116032

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Add BLAST21
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001464322 – 210T-cell surface glycoprotein CD8 beta chainAdd BLAST189

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi41 ↔ 116PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi102N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei209PhosphotyrosineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated as a consequence of T-cell activation.Curated
Palmitoylated at the cytoplasmic tail and thereby targets the heterodimer CD8A/CD8B to lipid rafts unlike CD8A homodimers.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P10966

PeptideAtlas

More...
PeptideAtlasi
P10966

PRoteomics IDEntifications database

More...
PRIDEi
P10966

ProteomicsDB human proteome resource

More...
ProteomicsDBi
52679 [P10966-1]
52680 [P10966-2]
52681 [P10966-3]
52682 [P10966-4]
52683 [P10966-6]
52684 [P10966-7]
52685 [P10966-8]
52686 [P10966-9]
61988

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P10966

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P10966

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P10966

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+ T-cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172116 Expressed in 106 organ(s), highest expression level in leukocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P10966 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P10966 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004353
HPA029164

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms disulfide-linked heterodimers with CD8A at the cell surface.

Interacts with CD3D; this interaction couples TCR-CD3 with CD8.

Interacts with LCK.

By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107364, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000331172

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P10966

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini22 – 132Ig-like V-typeAdd BLAST111

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IY5X Eukaryota
ENOG410ZF37 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000048998

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000008681

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P10966

KEGG Orthology (KO)

More...
KOi
K06459

Identification of Orthologs from Complete Genome Data

More...
OMAi
YFCMTIG

Database of Orthologous Groups

More...
OrthoDBi
1377095at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P10966

TreeFam database of animal gene trees

More...
TreeFami
TF338028

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR042414 CD8B
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set

The PANTHER Classification System

More...
PANTHERi
PTHR11292 PTHR11292, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07686 V-set, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P10966-1) [UniParc]FASTAAdd to basket
Also known as: M-1, Mbeta1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRPRLWLLLA AQLTVLHGNS VLQQTPAYIK VQTNKMVMLS CEAKISLSNM
60 70 80 90 100
RIYWLRQRQA PSSDSHHEFL ALWDSAKGTI HGEEVEQEKI AVFRDASRFI
110 120 130 140 150
LNLTSVKPED SGIYFCMIVG SPELTFGKGT QLSVVDFLPT TAQPTKKSTL
160 170 180 190 200
KKRVCRLPRP ETQKGPLCSP ITLGLLVAGV LVLLVSLGVA IHLCCRRRRA
210
RLRFMKQFYK
Length:210
Mass (Da):23,722
Last modified:July 1, 1989 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i675AD919585F4B80
GO
Isoform 2 (identifier: P10966-2) [UniParc]FASTAAdd to basket
Also known as: M-3, Mbeta2

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: FYK → LRLHPLEKCSRMDY

Show »
Length:221
Mass (Da):25,027
Checksum:iF5D8E834AE123671
GO
Isoform 3 (identifier: P10966-3) [UniParc]FASTAAdd to basket
Also known as: S-1, Sbeta3

The sequence of this isoform differs from the canonical sequence as follows:
     166-195: Missing.
     208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT

Show »
Length:213
Mass (Da):24,276
Checksum:i79F81C2F066900D3
GO
Isoform 4 (identifier: P10966-4) [UniParc]FASTAAdd to basket
Also known as: M-2

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: FYK → KFNIVCLKISGFTTCCCFQILQISREYGFGVLLQKDIGQ

Show »
Length:246
Mass (Da):27,681
Checksum:i33E6112A23CE59CD
GO
Isoform 5 (identifier: P10966-6) [UniParc]FASTAAdd to basket
Also known as: Mbeta3

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT

Show »
Length:243
Mass (Da):27,246
Checksum:i9D6B283609CC0752
GO
Isoform 6 (identifier: P10966-7) [UniParc]FASTAAdd to basket
Also known as: Sbeta1

The sequence of this isoform differs from the canonical sequence as follows:
     166-195: Missing.

Show »
Length:180
Mass (Da):20,752
Checksum:iDBE4D7A3B6A30F58
GO
Isoform 7 (identifier: P10966-8) [UniParc]FASTAAdd to basket
Also known as: Sbeta4

The sequence of this isoform differs from the canonical sequence as follows:
     165-210: GPLCSPITLG...RLRFMKQFYK → DFTNKQRIGF...TFNPGEFNGC

Show »
Length:206
Mass (Da):23,633
Checksum:iEE0A2D77A82570D4
GO
Isoform 8 (identifier: P10966-9) [UniParc]FASTAAdd to basket
Also known as: Sbeta5

The sequence of this isoform differs from the canonical sequence as follows:
     166-210: PLCSPITLGL...RLRFMKQFYK → LKGKVYQEPLSPNACMDTTAILQPHRSCLTHGS

Show »
Length:198
Mass (Da):22,237
Checksum:i57D5DEB69D193C5A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PD41E9PD41_HUMAN
T-cell surface glycoprotein CD8 bet...
CD8B
210Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD13877 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti173Missing no nucleotide entry (PubMed:8436166).Curated1
Sequence conflicti180V → I in AAI00915 (PubMed:15489334).Curated1
Isoform 5 (identifier: P10966-6)
Sequence conflicti213I → V in AAI00915 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039654165 – 210GPLCS…KQFYK → DFTNKQRIGFWCPATKRHRS VMSTMWKNERRDTFNPGEFN GC in isoform 7. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_039655166 – 210PLCSP…KQFYK → LKGKVYQEPLSPNACMDTTA ILQPHRSCLTHGS in isoform 8. 2 PublicationsAdd BLAST45
Alternative sequenceiVSP_002492166 – 195Missing in isoform 3 and isoform 6. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_002490208 – 210FYK → LRLHPLEKCSRMDY in isoform 2. 2 Publications3
Alternative sequenceiVSP_002493208 – 210FYK → PQGEGISGTFVPQCLHGYYS NTTTSQKLLNPWILKT in isoform 3 and isoform 5. 3 Publications3
Alternative sequenceiVSP_002491208 – 210FYK → KFNIVCLKISGFTTCCCFQI LQISREYGFGVLLQKDIGQ in isoform 4. Curated3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X13444 mRNA Translation: CAA31795.1
X13445 mRNA Translation: CAA31796.1
X13446 mRNA Translation: CAA31797.1
X13452 mRNA Translation: CAA31803.1
Y00805 mRNA Translation: CAA68750.1
M36712 mRNA Translation: AAA35664.1
S87090
, S87068, S87070, S87073, S87081 Genomic DNA Translation: AAB21669.2
S87087
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21670.2
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21671.2
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21672.2
AC111200 Genomic DNA No translation available.
BC100911 mRNA Translation: AAI00912.1
BC100912 mRNA Translation: AAI00913.1
BC100913 mRNA Translation: AAI00914.1
BC100914 mRNA Translation: AAI00915.1
S55731, S55730, S55733 Genomic DNA Translation: AAD13877.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1994.1 [P10966-3]
CCDS1995.1 [P10966-6]
CCDS1997.1 [P10966-1]
CCDS42708.1 [P10966-2]
CCDS54376.1 [P10966-9]

Protein sequence database of the Protein Information Resource

More...
PIRi
C49050
D46482
E49050
G49050
S01647 E46482
S01873 C46482
S01874 B46482
T01073

NCBI Reference Sequences

More...
RefSeqi
NP_001171571.1, NM_001178100.1 [P10966-9]
NP_004922.1, NM_004931.4 [P10966-1]
NP_742099.1, NM_172101.3 [P10966-2]
NP_742100.1, NM_172102.3 [P10966-3]
NP_757362.1, NM_172213.3 [P10966-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000331469; ENSP00000331172; ENSG00000172116 [P10966-6]
ENST00000349455; ENSP00000340592; ENSG00000172116 [P10966-3]
ENST00000390655; ENSP00000375070; ENSG00000172116 [P10966-1]
ENST00000393759; ENSP00000377356; ENSG00000172116 [P10966-2]
ENST00000393761; ENSP00000377358; ENSG00000172116 [P10966-9]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
926

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:926

UCSC genome browser

More...
UCSCi
uc002srw.4 human [P10966-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

CD8 entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X13444 mRNA Translation: CAA31795.1
X13445 mRNA Translation: CAA31796.1
X13446 mRNA Translation: CAA31797.1
X13452 mRNA Translation: CAA31803.1
Y00805 mRNA Translation: CAA68750.1
M36712 mRNA Translation: AAA35664.1
S87090
, S87068, S87070, S87073, S87081 Genomic DNA Translation: AAB21669.2
S87087
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21670.2
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21671.2
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA Translation: AAB21672.2
AC111200 Genomic DNA No translation available.
BC100911 mRNA Translation: AAI00912.1
BC100912 mRNA Translation: AAI00913.1
BC100913 mRNA Translation: AAI00914.1
BC100914 mRNA Translation: AAI00915.1
S55731, S55730, S55733 Genomic DNA Translation: AAD13877.1 Sequence problems.
CCDSiCCDS1994.1 [P10966-3]
CCDS1995.1 [P10966-6]
CCDS1997.1 [P10966-1]
CCDS42708.1 [P10966-2]
CCDS54376.1 [P10966-9]
PIRiC49050
D46482
E49050
G49050
S01647 E46482
S01873 C46482
S01874 B46482
T01073
RefSeqiNP_001171571.1, NM_001178100.1 [P10966-9]
NP_004922.1, NM_004931.4 [P10966-1]
NP_742099.1, NM_172101.3 [P10966-2]
NP_742100.1, NM_172102.3 [P10966-3]
NP_757362.1, NM_172213.3 [P10966-6]

3D structure databases

SMRiP10966
ModBaseiSearch...

Protein-protein interaction databases

BioGridi107364, 9 interactors
STRINGi9606.ENSP00000331172

PTM databases

iPTMnetiP10966
PhosphoSitePlusiP10966
SwissPalmiP10966

Polymorphism and mutation databases

BioMutaiCD8B
DMDMi116032

Proteomic databases

PaxDbiP10966
PeptideAtlasiP10966
PRIDEiP10966
ProteomicsDBi52679 [P10966-1]
52680 [P10966-2]
52681 [P10966-3]
52682 [P10966-4]
52683 [P10966-6]
52684 [P10966-7]
52685 [P10966-8]
52686 [P10966-9]
61988

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
926
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331469; ENSP00000331172; ENSG00000172116 [P10966-6]
ENST00000349455; ENSP00000340592; ENSG00000172116 [P10966-3]
ENST00000390655; ENSP00000375070; ENSG00000172116 [P10966-1]
ENST00000393759; ENSP00000377356; ENSG00000172116 [P10966-2]
ENST00000393761; ENSP00000377358; ENSG00000172116 [P10966-9]
GeneIDi926
KEGGihsa:926
UCSCiuc002srw.4 human [P10966-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
926
DisGeNETi926

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CD8B
HGNCiHGNC:1707 CD8B
HPAiCAB004353
HPA029164
MIMi186730 gene
neXtProtiNX_P10966
OpenTargetsiENSG00000172116
PharmGKBiPA26245

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IY5X Eukaryota
ENOG410ZF37 LUCA
GeneTreeiENSGT00510000048998
HOGENOMiHOG000008681
InParanoidiP10966
KOiK06459
OMAiYFCMTIG
OrthoDBi1377095at2759
PhylomeDBiP10966
TreeFamiTF338028

Enzyme and pathway databases

ReactomeiR-HSA-182218 Nef Mediated CD8 Down-regulation
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
926

Pharos

More...
Pharosi
P10966

Protein Ontology

More...
PROi
PR:P10966

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000172116 Expressed in 106 organ(s), highest expression level in leukocyte
ExpressionAtlasiP10966 baseline and differential
GenevisibleiP10966 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR042414 CD8B
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PANTHERiPTHR11292 PTHR11292, 1 hit
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCD8B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P10966
Secondary accession number(s): P14860
, P14861, Q15980, Q496E0, Q496E1, Q496E2, Q9UDB4, Q9UDB5, Q9UDB6, Q9UDB7, Q9UDB8, Q9UDB9, Q9UDC0, Q9UQ55
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: July 1, 1989
Last modified: September 18, 2019
This is version 192 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again