Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 191 (16 Oct 2019)
Sequence version 2 (29 Aug 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

cAMP-dependent protein kinase type I regulatory subunit

Gene

Pka-R1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei197cAMP 11
Binding sitei206cAMP 11
Binding sitei321cAMP 21
Binding sitei330cAMP 21

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi132 – 247cAMP 1Add BLAST116
Nucleotide bindingi250 – 371cAMP 2Add BLAST122

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandcAMP, cAMP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-163615 PKA activation
R-DME-164378 PKA activation in glucagon signalling
R-DME-180024 DARPP-32 events
R-DME-432040 Vasopressin regulates renal water homeostasis via Aquaporins
R-DME-442720 CREB1 phosphorylation through the activation of Adenylate Cyclase
R-DME-5610787 Hedgehog 'off' state
R-DME-983231 Factors involved in megakaryocyte development and platelet production

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
cAMP-dependent protein kinase type I regulatory subunit
Short name:
DRI class I to class IV
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pka-R1
Synonyms:CdkR
ORF Names:CG3263
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0259243 Pka-R1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002053961 – 376cAMP-dependent protein kinase type I regulatory subunitAdd BLAST376

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi17Interchain (with C-38)By similarity
Disulfide bondi38Interchain (with C-17)By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei96PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The pseudophosphorylation site binds to the substrate-binding region of the catalytic chain but is not phosphorylated. The physiological significance of phosphorylations by other kinases is unclear.

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P16905

PRoteomics IDEntifications database

More...
PRIDEi
P16905

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0259243 Expressed in 36 organ(s), highest expression level in head

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P16905 differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P16905 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Tetramer, composed of 2 regulatory (R) and 2 catalytic (C) subunits. In the presence of cAMP it dissociates into 2 active monomeric C subunits and an R dimer.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
65562, 11 interactors

Database of interacting proteins

More...
DIPi
DIP-23282N

Protein interaction database and analysis system

More...
IntActi
P16905, 4 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0291777

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 131Dimerization and phosphorylationAdd BLAST131

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi91 – 95Pseudophosphorylation motif5

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1113 Eukaryota
COG0664 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157513

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P16905

KEGG Orthology (KO)

More...
KOi
K04739

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P16905

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00038 CAP_ED, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012198 cAMP_dep_PK_reg_su
IPR003117 cAMP_dep_PK_reg_su_I/II_a/b
IPR018490 cNMP-bd-like
IPR018488 cNMP-bd_CS
IPR000595 cNMP-bd_dom
IPR014710 RmlC-like_jellyroll

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00027 cNMP_binding, 2 hits
PF02197 RIIa, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000548 PK_regulatory, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00100 cNMP, 2 hits
SM00394 RIIa, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51206 SSF51206, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00888 CNMP_BINDING_1, 2 hits
PS00889 CNMP_BINDING_2, 2 hits
PS50042 CNMP_BINDING_3, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P16905-1) [UniParc]FASTAAdd to basket
Also known as: DRI-1, A, C, G, H, I, J

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSYMMAKTLE EQSLRECEHY IQTHGIQRVL KDCIVQLCVC RPENPVQFLR
60 70 80 90 100
QYFQKLEREQ VKLDASRQVI SPDDCEDLSP MPQTAAPPVR RRGGISAEPV
110 120 130 140 150
TEEDATNYVK KVVPKDYKTM NALSKAIAKN VLFAHLDESE RSDIFDAMFP
160 170 180 190 200
VNHIAGENII QQGDEGDNFY VIDVGEVDVF VNSELVTTIS EGGSFGELAL
210 220 230 240 250
IYGTPRAATV RAKTDVKLWG IDRDSYRRIL MGSTIRKRKM YEEFLSRVSI
260 270 280 290 300
LESLDKWERL TVADSLETCS FDDGETIVKQ GAAGDDFYII LEGCAVVLQQ
310 320 330 340 350
RSEGEDPAEV GRLGSSDYFG EIALLLDRPR AATVVARGPL KCVKLDRARF
360 370
ERVLGPCADI LKRNITQYNS FVSLSV
Length:376
Mass (Da):42,239
Last modified:August 29, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF7B89D9C3EC313A5
GO
Isoform 2 (identifier: P16905-2) [UniParc]FASTAAdd to basket
Also known as: DRI-2, D

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: MSYMMAKTLEEQSLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLER → MPK

Show »
Length:321
Mass (Da):35,551
Checksum:i644D55160B4752A5
GO
Isoform 3 (identifier: P16905-3) [UniParc]FASTAAdd to basket
Also known as: DRI-3-4, B, F

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.

Show »
Length:296
Mass (Da):32,768
Checksum:i56143C5389FA0CFD
GO
Isoform E (identifier: P16905-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-58: Missing.

Note: No experimental confirmation available.
Show »
Length:319
Mass (Da):35,326
Checksum:i32E6701C3CD4A40A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q9VPA7Q9VPA7_DROME
Protein kinase, cAMP-dependent, reg...
Pka-R1 18304, CdkR, CG12452, CG18677, CG3263
463Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MS76M9MS76_DROME
Protein kinase, cAMP-dependent, reg...
Pka-R1 18304, CdkR, CG12452, CG18677, CG3263
464Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H1UUF3H1UUF3_DROME
FI18174p1
Pka-R1 18304, CdkR, CG12452, CG18677, CG3263
322Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MS37M9MS37_DROME
Protein kinase, cAMP-dependent, reg...
Pka-R1 18304, CdkR, CG12452, CG18677, CG3263
320Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MRY3M9MRY3_DROME
Protein kinase, cAMP-dependent, reg...
Pka-R1 18304, CdkR, CG12452, CG18677, CG3263
377Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MS72M9MS72_DROME
Protein kinase, cAMP-dependent, reg...
Pka-R1 18304, CdkR, CG12452, CG18677, CG3263
297Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAN71433 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti303E → EQ in CAA34837 (PubMed:3215511).Curated1
Sequence conflicti303E → EQ in CAA34838 (PubMed:3215511).Curated1
Sequence conflicti303E → EQ in CAA34839 (PubMed:3215511).Curated1
Sequence conflicti303E → EQ in CAA34841 (PubMed:3215511).Curated1
Isoform 2 (identifier: P16905-2)
Sequence conflicti1 – 3MPK → M in CAA34837 (PubMed:3215511).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0027961 – 80Missing in isoform 3. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_0027951 – 58MSYMM…QKLER → MPK in isoform 2. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_0360662 – 58Missing in isoform E. CuratedAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X16963, X16964 Genomic DNA Translation: CAA34837.1
X16970, X16971 Genomic DNA Translation: CAA34841.1
X16966 Genomic DNA Translation: CAA34838.1
X16968 Genomic DNA Translation: CAA34839.1
AE014296 Genomic DNA Translation: AAF51649.3
AE014296 Genomic DNA Translation: AAG22179.2
AE014296 Genomic DNA Translation: AAN12146.2
AE014296 Genomic DNA Translation: AAN12147.1
AE014296 Genomic DNA Translation: AAX52761.1
AE014296 Genomic DNA Translation: AAX52762.1
AE014296 Genomic DNA Translation: AAX52763.1
AE014296 Genomic DNA Translation: AAX52764.1
AE014296 Genomic DNA Translation: AAX52765.1
AE014296 Genomic DNA Translation: AAX52766.1
AY058709 mRNA Translation: AAL13938.1
AY122131 mRNA Translation: AAM52643.1
BT001678 mRNA Translation: AAN71433.1 Frameshift.

Protein sequence database of the Protein Information Resource

More...
PIRi
A31751 OKFF1R

NCBI Reference Sequences

More...
RefSeqi
NP_001014593.1, NM_001014593.3 [P16905-1]
NP_001014594.1, NM_001014594.3 [P16905-1]
NP_001014595.1, NM_001014595.3 [P16905-1]
NP_001014596.1, NM_001014596.3 [P16905-1]
NP_001014597.1, NM_001014597.2 [P16905-3]
NP_001014598.1, NM_001014598.2 [P16905-4]
NP_001189145.1, NM_001202216.1
NP_001189146.1, NM_001202217.1
NP_001189147.1, NM_001202218.2
NP_001189148.1, NM_001202219.2
NP_001189149.1, NM_001202220.2
NP_524189.2, NM_079465.4 [P16905-3]
NP_730573.2, NM_168875.4 [P16905-1]
NP_730574.2, NM_168876.6 [P16905-1]
NP_730576.1, NM_168877.2 [P16905-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0299891; FBpp0289169; FBgn0259243 [P16905-1]
FBtr0299892; FBpp0289170; FBgn0259243 [P16905-1]
FBtr0300528; FBpp0289755; FBgn0259243 [P16905-1]
FBtr0300529; FBpp0289756; FBgn0259243 [P16905-3]
FBtr0300530; FBpp0289757; FBgn0259243 [P16905-1]
FBtr0300531; FBpp0289758; FBgn0259243 [P16905-2]
FBtr0300532; FBpp0289759; FBgn0259243 [P16905-4]
FBtr0300533; FBpp0289760; FBgn0259243 [P16905-3]
FBtr0300534; FBpp0289761; FBgn0259243 [P16905-1]
FBtr0300535; FBpp0289762; FBgn0259243 [P16905-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
40305

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG42341

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16963, X16964 Genomic DNA Translation: CAA34837.1
X16970, X16971 Genomic DNA Translation: CAA34841.1
X16966 Genomic DNA Translation: CAA34838.1
X16968 Genomic DNA Translation: CAA34839.1
AE014296 Genomic DNA Translation: AAF51649.3
AE014296 Genomic DNA Translation: AAG22179.2
AE014296 Genomic DNA Translation: AAN12146.2
AE014296 Genomic DNA Translation: AAN12147.1
AE014296 Genomic DNA Translation: AAX52761.1
AE014296 Genomic DNA Translation: AAX52762.1
AE014296 Genomic DNA Translation: AAX52763.1
AE014296 Genomic DNA Translation: AAX52764.1
AE014296 Genomic DNA Translation: AAX52765.1
AE014296 Genomic DNA Translation: AAX52766.1
AY058709 mRNA Translation: AAL13938.1
AY122131 mRNA Translation: AAM52643.1
BT001678 mRNA Translation: AAN71433.1 Frameshift.
PIRiA31751 OKFF1R
RefSeqiNP_001014593.1, NM_001014593.3 [P16905-1]
NP_001014594.1, NM_001014594.3 [P16905-1]
NP_001014595.1, NM_001014595.3 [P16905-1]
NP_001014596.1, NM_001014596.3 [P16905-1]
NP_001014597.1, NM_001014597.2 [P16905-3]
NP_001014598.1, NM_001014598.2 [P16905-4]
NP_001189145.1, NM_001202216.1
NP_001189146.1, NM_001202217.1
NP_001189147.1, NM_001202218.2
NP_001189148.1, NM_001202219.2
NP_001189149.1, NM_001202220.2
NP_524189.2, NM_079465.4 [P16905-3]
NP_730573.2, NM_168875.4 [P16905-1]
NP_730574.2, NM_168876.6 [P16905-1]
NP_730576.1, NM_168877.2 [P16905-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi65562, 11 interactors
DIPiDIP-23282N
IntActiP16905, 4 interactors
STRINGi7227.FBpp0291777

Proteomic databases

PaxDbiP16905
PRIDEiP16905

Genome annotation databases

EnsemblMetazoaiFBtr0299891; FBpp0289169; FBgn0259243 [P16905-1]
FBtr0299892; FBpp0289170; FBgn0259243 [P16905-1]
FBtr0300528; FBpp0289755; FBgn0259243 [P16905-1]
FBtr0300529; FBpp0289756; FBgn0259243 [P16905-3]
FBtr0300530; FBpp0289757; FBgn0259243 [P16905-1]
FBtr0300531; FBpp0289758; FBgn0259243 [P16905-2]
FBtr0300532; FBpp0289759; FBgn0259243 [P16905-4]
FBtr0300533; FBpp0289760; FBgn0259243 [P16905-3]
FBtr0300534; FBpp0289761; FBgn0259243 [P16905-1]
FBtr0300535; FBpp0289762; FBgn0259243 [P16905-1]
GeneIDi40305
KEGGidme:Dmel_CG42341

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
40305
FlyBaseiFBgn0259243 Pka-R1

Phylogenomic databases

eggNOGiKOG1113 Eukaryota
COG0664 LUCA
GeneTreeiENSGT00940000157513
InParanoidiP16905
KOiK04739
PhylomeDBiP16905

Enzyme and pathway databases

ReactomeiR-DME-163615 PKA activation
R-DME-164378 PKA activation in glucagon signalling
R-DME-180024 DARPP-32 events
R-DME-432040 Vasopressin regulates renal water homeostasis via Aquaporins
R-DME-442720 CREB1 phosphorylation through the activation of Adenylate Cyclase
R-DME-5610787 Hedgehog 'off' state
R-DME-983231 Factors involved in megakaryocyte development and platelet production

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Pka-R1 fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
40305

Protein Ontology

More...
PROi
PR:P16905

Gene expression databases

BgeeiFBgn0259243 Expressed in 36 organ(s), highest expression level in head
ExpressionAtlasiP16905 differential
GenevisibleiP16905 DM

Family and domain databases

CDDicd00038 CAP_ED, 2 hits
Gene3Di2.60.120.10, 2 hits
InterProiView protein in InterPro
IPR012198 cAMP_dep_PK_reg_su
IPR003117 cAMP_dep_PK_reg_su_I/II_a/b
IPR018490 cNMP-bd-like
IPR018488 cNMP-bd_CS
IPR000595 cNMP-bd_dom
IPR014710 RmlC-like_jellyroll
PfamiView protein in Pfam
PF00027 cNMP_binding, 2 hits
PF02197 RIIa, 1 hit
PIRSFiPIRSF000548 PK_regulatory, 1 hit
SMARTiView protein in SMART
SM00100 cNMP, 2 hits
SM00394 RIIa, 1 hit
SUPFAMiSSF51206 SSF51206, 2 hits
PROSITEiView protein in PROSITE
PS00888 CNMP_BINDING_1, 2 hits
PS00889 CNMP_BINDING_2, 2 hits
PS50042 CNMP_BINDING_3, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKAPR1_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P16905
Secondary accession number(s): A4V272
, A4V277, Q59E10, Q8IGP3, Q8IPU2, Q8MR47, Q95TK7, Q9VPA6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: August 29, 2003
Last modified: October 16, 2019
This is version 191 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again