Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 188 (13 Nov 2019)
Sequence version 2 (21 Feb 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Alpha-actinin, sarcomeric

Gene

Actn

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi791 – 8021PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi832 – 8432PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: UniProtKB
  • actin filament binding Source: UniProtKB
  • calcium ion binding Source: InterPro

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-114608 Platelet degranulation
R-DME-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-DME-446388 Regulation of cytoskeletal remodeling and cell spreading by IPP complex components

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Alpha-actinin, sarcomeric
Alternative name(s):
F-actin cross-linking protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Actn
Synonyms:fliA, l(1)2Cb
ORF Names:CG4376
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0000667 Actn

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000734471 – 924Alpha-actinin, sarcomericAdd BLAST924

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P18091

PRoteomics IDEntifications database

More...
PRIDEi
P18091

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Larval muscle isoform is expressed in the larval body wall, adult muscles of the head and abdomen and supercontractile muscles of the larva and adult. Adult muscle isoform accumulates within adult fibrillar and tubular muscles.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Larval muscle isoform is found in the larvae and adults, the adult muscle isoform in adults only.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0000667 Expressed in 44 organ(s), highest expression level in head

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P18091 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; antiparallel.

Interacts with Smn; the interaction occurs in adult thoracic tissues.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
57710, 45 interactors

Database of interacting proteins

More...
DIPi
DIP-22313N

Protein interaction database and analysis system

More...
IntActi
P18091, 12 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0070331

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P18091

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini34 – 138Calponin-homology (CH) 1PROSITE-ProRule annotationAdd BLAST105
Domaini147 – 253Calponin-homology (CH) 2PROSITE-ProRule annotationAdd BLAST107
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati251 – 395Spectrin 1Add BLAST145
Repeati396 – 510Spectrin 2Add BLAST115
Repeati511 – 631Spectrin 3Add BLAST121
Repeati632 – 744Spectrin 4Add BLAST113
Domaini778 – 813EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini819 – 854EF-hand 2PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 250Actin-bindingAdd BLAST250

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the alpha-actinin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0035 Eukaryota
COG5069 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155548

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P18091

KEGG Orthology (KO)

More...
KOi
K05699

Identification of Orthologs from Complete Genome Data

More...
OMAi
QRFENVN

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P18091

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00014 CH, 2 hits
cd00051 EFh, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001589 Actinin_actin-bd_CS
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR011992 EF-hand-dom_pair
IPR014837 EF-hand_Ca_insen
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR018159 Spectrin/alpha-actinin
IPR002017 Spectrin_repeat

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00307 CH, 2 hits
PF13405 EF-hand_6, 1 hit
PF08726 EFhand_Ca_insen, 1 hit
PF00435 Spectrin, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033 CH, 2 hits
SM00054 EFh, 2 hits
SM00150 SPEC, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 1 hit
SSF47576 SSF47576, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00019 ACTININ_1, 1 hit
PS00020 ACTININ_2, 1 hit
PS50021 CH, 2 hits
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Long (identifier: P18091-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMMENGLSME YGDGYMEQEE EWEREGLLDP AWEKQQKKTF TAWCNSHLRK
60 70 80 90 100
AGTAIDNIEE DFRNGLKLML LLEVISGETL PKPDRGKMRF HKIANVNKAL
110 120 130 140 150
DFIASKGVHL VSIGAEEIVD GNLKMTLGMI WTIILRFAIQ DISVEEMTAK
160 170 180 190 200
EGLLLWCQRK TAPYKNVNVQ NFHLSFKDGL AFCALIHRHR PDLIDYAKLS
210 220 230 240 250
KDNPLENLNT AFDVAEKYLD IPRMLDPDDL INTPKPDERA IMTYVSCYYH
260 270 280 290 300
AFQGAQQVGN NTALPDERAV MTYVSSYYHC FSGAQKAETA ANRICKVLKV
310 320 330 340 350
NQENERLMEE YERLASDLLE WIRRTMPWLN SRQADNSLAG VQKKLEEYRT
360 370 380 390 400
YRRKHKPPRV EQKAKLETNF NTLQTKLRLS NRPAYLPTEG KTVSDISNSW
410 420 430 440 450
KGLELAEKAF EEWLLAETMR LERLEHLAQK FKHKADAHED WTRGKEEMLQ
460 470 480 490 500
SQDFRQCKLN ELKALKKKHE AFESDLAAHQ DRVEQIAAIA QELNTLEYHD
510 520 530 540 550
CVSVNARCQR ICDQWDRLGA LTQRRRTALD EAERILEKID ILHLEFAKRA
560 570 580 590 600
APFNNWLDGT REDLVDMFIV HTMEEIQGLI QAHDQFKATL GEADKEFNLI
610 620 630 640 650
VNLVREVESI VKQHQIPGGL ENPYTTLTAN DMTRKWSDVR QLVPQRDQTL
660 670 680 690 700
ANELRKQQNN EMLRRQFAEK ANIVGPWIER QMDAVTAIGM GLQGSLEDQL
710 720 730 740 750
HRLKEYEQAV YAYKPNIEEL EKIHQAVQES MIFENRYTNY TMETLRVGWE
760 770 780 790 800
QLLTSINRNI NEVENQILTR DSKGISQEQL NEFRSSFNHF DKNRTGRLSP
810 820 830 840 850
EEFKSCLVSL GYSIGKDRQG DLDFQRILAV VDPNNTGYVH FDAFLDFMTR
860 870 880 890 900
ESTDTDTAEQ VIDSFRILAA DKPYILPDEL RRELPPDQAE YCIQRMPPYK
910 920
GPNGVPGALD YMSFSTALYG ETDL
Length:924
Mass (Da):107,019
Last modified:February 21, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i08F8961520328ACE
GO
Isoform Non-muscle (identifier: P18091-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-260: Missing.
     261-261: N → Q

Show »
Length:892
Mass (Da):103,420
Checksum:iCDE214DD3B7E5A72
GO
Isoform Larval muscle (identifier: P18091-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     261-286: NTALPDERAVMTYVSSYYHCFSGAQK → VTHVPEPTRQYTYVPNNYN

Show »
Length:917
Mass (Da):106,373
Checksum:i31573181B7230DAA
GO
Isoform Adult muscle (identifier: P18091-4) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     258-286: Missing.

Show »
Length:895
Mass (Da):103,828
Checksum:i196879A84FB0E259
GO
Isoform A (identifier: P18091-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     231-260: INTPKPDERAIMTYVSCYYHAFQGAQQVGN → Q

Show »
Length:895
Mass (Da):103,763
Checksum:iFB2D59D86C6B9619
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F0JAG6F0JAG6_DROME
Alpha actinin, isoform F
Actn ACTN, actn, Actn-RA, alpha-actinin, alphaActn
897Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PGA7M9PGA7_DROME
Alpha actinin, isoform G
Actn ACTN, actn, alpha-actinin, alphaActn, CT14163
917Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MS06M9MS06_DROME
Alpha actinin, isoform D
Actn ACTN, actn, alpha-actinin, alphaActn, CT14163
895Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti409A → G in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti457C → Y in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti474S → C in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti503S → C in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti574E → V in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti654L → R in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti684 – 691AVTAIGMG → VVTPLVWD in CAA36042 (PubMed:2112549).Curated8
Sequence conflicti711Y → H in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti817D → E in CAA36042 (PubMed:2112549).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000712229 – 260Missing in isoform Non-muscle. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_000713231 – 260INTPK…QQVGN → Q in isoform A. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_000715258 – 286Missing in isoform Adult muscle. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000716261 – 286NTALP…SGAQK → VTHVPEPTRQYTYVPNNYN in isoform Larval muscle. CuratedAdd BLAST26
Alternative sequenceiVSP_000714261N → Q in isoform Non-muscle. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X51753 mRNA Translation: CAA36042.1
AE014298 Genomic DNA Translation: AAF45705.2
AE014298 Genomic DNA Translation: AAF45706.2
AE014298 Genomic DNA Translation: AAN09068.1
AL009192, AL031765 Genomic DNA Translation: CAA15688.1
AL009192, AL031765 Genomic DNA Translation: CAA15689.1
AL031765, AL009192 Genomic DNA Translation: CAA21120.1
AL031765, AL009192 Genomic DNA Translation: CAA21121.1
AY069615 mRNA Translation: AAL39760.1
X64419 mRNA Translation: CAA45764.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A35598 FAFFAA
T13413
T13414

NCBI Reference Sequences

More...
RefSeqi
NP_001188532.1, NM_001201603.2 [P18091-4]
NP_001188533.1, NM_001201604.2 [P18091-4]
NP_001259165.1, NM_001272236.1 [P18091-3]
NP_001259166.1, NM_001272237.1 [P18091-3]
NP_001259167.1, NM_001272238.1 [P18091-3]
NP_477484.2, NM_058136.4 [P18091-5]
NP_477485.1, NM_058137.6 [P18091-3]
NP_726784.1, NM_166920.2 [P18091-4]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0070343; FBpp0070329; FBgn0000667 [P18091-4]
FBtr0070344; FBpp0070330; FBgn0000667 [P18091-5]
FBtr0070345; FBpp0070331; FBgn0000667 [P18091-3]
FBtr0303048; FBpp0292167; FBgn0000667 [P18091-4]
FBtr0310658; FBpp0302778; FBgn0000667 [P18091-3]
FBtr0310659; FBpp0302779; FBgn0000667 [P18091-3]
FBtr0333801; FBpp0305935; FBgn0000667 [P18091-4]
FBtr0333802; FBpp0305936; FBgn0000667 [P18091-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
31166

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG4376

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X51753 mRNA Translation: CAA36042.1
AE014298 Genomic DNA Translation: AAF45705.2
AE014298 Genomic DNA Translation: AAF45706.2
AE014298 Genomic DNA Translation: AAN09068.1
AL009192, AL031765 Genomic DNA Translation: CAA15688.1
AL009192, AL031765 Genomic DNA Translation: CAA15689.1
AL031765, AL009192 Genomic DNA Translation: CAA21120.1
AL031765, AL009192 Genomic DNA Translation: CAA21121.1
AY069615 mRNA Translation: AAL39760.1
X64419 mRNA Translation: CAA45764.1
PIRiA35598 FAFFAA
T13413
T13414
RefSeqiNP_001188532.1, NM_001201603.2 [P18091-4]
NP_001188533.1, NM_001201604.2 [P18091-4]
NP_001259165.1, NM_001272236.1 [P18091-3]
NP_001259166.1, NM_001272237.1 [P18091-3]
NP_001259167.1, NM_001272238.1 [P18091-3]
NP_477484.2, NM_058136.4 [P18091-5]
NP_477485.1, NM_058137.6 [P18091-3]
NP_726784.1, NM_166920.2 [P18091-4]

3D structure databases

SMRiP18091
ModBaseiSearch...

Protein-protein interaction databases

BioGridi57710, 45 interactors
DIPiDIP-22313N
IntActiP18091, 12 interactors
STRINGi7227.FBpp0070331

Proteomic databases

PaxDbiP18091
PRIDEiP18091

Genome annotation databases

EnsemblMetazoaiFBtr0070343; FBpp0070329; FBgn0000667 [P18091-4]
FBtr0070344; FBpp0070330; FBgn0000667 [P18091-5]
FBtr0070345; FBpp0070331; FBgn0000667 [P18091-3]
FBtr0303048; FBpp0292167; FBgn0000667 [P18091-4]
FBtr0310658; FBpp0302778; FBgn0000667 [P18091-3]
FBtr0310659; FBpp0302779; FBgn0000667 [P18091-3]
FBtr0333801; FBpp0305935; FBgn0000667 [P18091-4]
FBtr0333802; FBpp0305936; FBgn0000667 [P18091-3]
GeneIDi31166
KEGGidme:Dmel_CG4376

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
31166
FlyBaseiFBgn0000667 Actn

Phylogenomic databases

eggNOGiKOG0035 Eukaryota
COG5069 LUCA
GeneTreeiENSGT00940000155548
InParanoidiP18091
KOiK05699
OMAiQRFENVN
PhylomeDBiP18091

Enzyme and pathway databases

ReactomeiR-DME-114608 Platelet degranulation
R-DME-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-DME-446388 Regulation of cytoskeletal remodeling and cell spreading by IPP complex components

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Actn fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
31166

Protein Ontology

More...
PROi
PR:P18091

Gene expression databases

BgeeiFBgn0000667 Expressed in 44 organ(s), highest expression level in head
GenevisibleiP18091 DM

Family and domain databases

CDDicd00014 CH, 2 hits
cd00051 EFh, 1 hit
Gene3Di1.10.418.10, 2 hits
InterProiView protein in InterPro
IPR001589 Actinin_actin-bd_CS
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR011992 EF-hand-dom_pair
IPR014837 EF-hand_Ca_insen
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR018159 Spectrin/alpha-actinin
IPR002017 Spectrin_repeat
PfamiView protein in Pfam
PF00307 CH, 2 hits
PF13405 EF-hand_6, 1 hit
PF08726 EFhand_Ca_insen, 1 hit
PF00435 Spectrin, 4 hits
SMARTiView protein in SMART
SM00033 CH, 2 hits
SM00054 EFh, 2 hits
SM00150 SPEC, 4 hits
SUPFAMiSSF47473 SSF47473, 1 hit
SSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS00019 ACTININ_1, 1 hit
PS00020 ACTININ_2, 1 hit
PS50021 CH, 2 hits
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACTN_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P18091
Secondary accession number(s): O46044
, O46045, Q24370, Q8T024, Q9W536, Q9W537
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: February 21, 2001
Last modified: November 13, 2019
This is version 188 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again