Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (13 Feb 2019)
Sequence version 1 (01 Feb 1991)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Phosducin

Gene

PDC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism. Inhibits the transcriptional activation activity of the cone-rod homeobox CRX.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • phospholipase inhibitor activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processSensory transduction, Vision

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P20941

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P20941

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosducin
Short name:
PHD
Alternative name(s):
33 kDa phototransducing protein
Protein MEKA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PDC
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000116703.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8759 PDC

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
171490 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P20941

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5132

Open Targets

More...
OpenTargetsi
ENSG00000116703

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33109

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PDC

Domain mapping of disease mutations (DMDM)

More...
DMDMi
130134

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001637521 – 246PhosducinAdd BLAST246

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei73Phosphoserine; by PKABy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Light-induced changes in cyclic nucleotide levels modulate the phosphorylation of this protein by cAMP kinase.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P20941

PeptideAtlas

More...
PeptideAtlasi
P20941

PRoteomics IDEntifications database

More...
PRIDEi
P20941

ProteomicsDB human proteome resource

More...
ProteomicsDBi
53830
53831 [P20941-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P20941

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P20941

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000116703 Expressed in 60 organ(s), highest expression level in pigmented layer of retina

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P20941 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P20941 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA062235

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a complex with the beta and gamma subunits of the GTP-binding protein, transducin. Interacts with CRX.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111159, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000342033

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P20941

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P20941

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni111 – 246Thioredoxin foldBy similarityAdd BLAST136

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the phosducin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3171 Eukaryota
ENOG4110DRD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156236

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232010

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG003456

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P20941

KEGG Orthology (KO)

More...
KOi
K08327

Identification of Orthologs from Complete Genome Data

More...
OMAi
AAEYPMV

Database of Orthologous Groups

More...
OrthoDBi
1324495at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P20941

TreeFam database of animal gene trees

More...
TreeFami
TF315179

Family and domain databases

Conserved Domains Database

More...
CDDi
cd02987 Phd_like_Phd, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.168.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001200 Phosducin
IPR023196 Phosducin_N_dom_sf
IPR024253 Phosducin_thioredoxin-like_dom
IPR036249 Thioredoxin-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02114 Phosducin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00677 PHOSDUCIN

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52833 SSF52833, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P20941-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEAKSQSLE EDFEGQATHT GPKGVINDWR KFKLESQDSD SIPPSKKEIL
60 70 80 90 100
RQMSSPQSRN GKDSKERVSR KMSIQEYELI HKEKEDENCL RKYRRQCMQD
110 120 130 140 150
MHQKLSFGPR YGFVYELETG KQFLETIEKE LKITTIVVHI YEDGIKGCDA
160 170 180 190 200
LNSSLTCLAA EYPIVKFCKI KASNTGAGDR FSLDVLPTLL IYKGGELISN
210 220 230 240
FISVAEQFAE EFFAGDVESF LNEYGLLPER EVHVLEHTKI EEEDVE
Length:246
Mass (Da):28,246
Last modified:February 1, 1991 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDF59C2C7C3308C90
GO
Isoform 2 (identifier: P20941-2) [UniParc]FASTAAdd to basket
Also known as: PhLOP1

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.

Show »
Length:194
Mass (Da):22,317
Checksum:i228ADD7757825F29
GO
Isoform 3 (identifier: P20941-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPESLDSPTSGRPGVTTHSTRTPGTEIQTIISNPVPKM

Show »
Length:283
Mass (Da):32,118
Checksum:iB9637E3DF21C470D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti140I → L in AAA36210 (PubMed:2383274).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0438801 – 52Missing in isoform 2. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_0537781M → MPESLDSPTSGRPGVTTHST RTPGTEIQTIISNPVPKM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M33478 mRNA Translation: AAA35486.1
M38059, M60720, M38058 Genomic DNA Translation: AAA36210.1
AF076463 mRNA Translation: AAD43141.1
AF076464 mRNA Translation: AAD43142.1
AL596220 Genomic DNA No translation available.
AL663036 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91212.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1370.1 [P20941-1]
CCDS41447.1 [P20941-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A35422

NCBI Reference Sequences

More...
RefSeqi
NP_002588.3, NM_002597.4 [P20941-1]
NP_072098.1, NM_022576.3 [P20941-2]
XP_011507905.1, XM_011509603.2 [P20941-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.654381

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000391997; ENSP00000375855; ENSG00000116703 [P20941-1]
ENST00000497198; ENSP00000422775; ENSG00000116703 [P20941-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5132

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5132

UCSC genome browser

More...
UCSCi
uc001grz.4 human [P20941-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Mutations of the PDC gene

Retina International's Scientific Newsletter

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M33478 mRNA Translation: AAA35486.1
M38059, M60720, M38058 Genomic DNA Translation: AAA36210.1
AF076463 mRNA Translation: AAD43141.1
AF076464 mRNA Translation: AAD43142.1
AL596220 Genomic DNA No translation available.
AL663036 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91212.1
CCDSiCCDS1370.1 [P20941-1]
CCDS41447.1 [P20941-2]
PIRiA35422
RefSeqiNP_002588.3, NM_002597.4 [P20941-1]
NP_072098.1, NM_022576.3 [P20941-2]
XP_011507905.1, XM_011509603.2 [P20941-1]
UniGeneiHs.654381

3D structure databases

ProteinModelPortaliP20941
SMRiP20941
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111159, 3 interactors
STRINGi9606.ENSP00000342033

PTM databases

iPTMnetiP20941
PhosphoSitePlusiP20941

Polymorphism and mutation databases

BioMutaiPDC
DMDMi130134

Proteomic databases

PaxDbiP20941
PeptideAtlasiP20941
PRIDEiP20941
ProteomicsDBi53830
53831 [P20941-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5132
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000391997; ENSP00000375855; ENSG00000116703 [P20941-1]
ENST00000497198; ENSP00000422775; ENSG00000116703 [P20941-2]
GeneIDi5132
KEGGihsa:5132
UCSCiuc001grz.4 human [P20941-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5132
DisGeNETi5132
EuPathDBiHostDB:ENSG00000116703.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PDC

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0028533
HGNCiHGNC:8759 PDC
HPAiHPA062235
MIMi171490 gene
neXtProtiNX_P20941
OpenTargetsiENSG00000116703
PharmGKBiPA33109

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3171 Eukaryota
ENOG4110DRD LUCA
GeneTreeiENSGT00940000156236
HOGENOMiHOG000232010
HOVERGENiHBG003456
InParanoidiP20941
KOiK08327
OMAiAAEYPMV
OrthoDBi1324495at2759
PhylomeDBiP20941
TreeFamiTF315179

Enzyme and pathway databases

SignaLinkiP20941
SIGNORiP20941

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PDC human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Phosducin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5132

Protein Ontology

More...
PROi
PR:P20941

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000116703 Expressed in 60 organ(s), highest expression level in pigmented layer of retina
ExpressionAtlasiP20941 baseline and differential
GenevisibleiP20941 HS

Family and domain databases

CDDicd02987 Phd_like_Phd, 1 hit
Gene3Di1.10.168.10, 2 hits
InterProiView protein in InterPro
IPR001200 Phosducin
IPR023196 Phosducin_N_dom_sf
IPR024253 Phosducin_thioredoxin-like_dom
IPR036249 Thioredoxin-like_sf
PfamiView protein in Pfam
PF02114 Phosducin, 1 hit
PRINTSiPR00677 PHOSDUCIN
SUPFAMiSSF52833 SSF52833, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHOS_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P20941
Secondary accession number(s): Q14816, Q9UP22, Q9UP23
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: February 13, 2019
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again