Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 213 (16 Oct 2019)
Sequence version 3 (15 Feb 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Threonine--tRNA ligase 1, cytoplasmic

Gene

TARS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the attachment of threonine to tRNA(Thr) in a two-step reaction: threonine is first activated by ATP to form Thr-AMP and then transferred to the acceptor end of tRNA(Thr) (PubMed:25824639). Also edits incorrectly charged tRNA(Thr) via its editing domain, at the post-transfer stage (By similarity).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by borrelidin (BN, IC 50 is 7 nM), which binds to 4 distinct subsites in the protein, preventing binding of all 3 substrates (PubMed:25824639).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein homodimerization activity Source: UniProtKB
  • threonine-tRNA ligase activity Source: UniProtKB
  • tRNA binding Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAminoacyl-tRNA synthetase, Ligase, RNA-binding, tRNA-binding
Biological processProtein biosynthesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
6.1.1.3 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-379716 Cytosolic tRNA aminoacylation

Protein family/group databases

MoonProt database of moonlighting proteins

More...
MoonProti
P26639

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Threonine--tRNA ligase 1, cytoplasmicCurated (EC:6.1.1.31 Publication)
Alternative name(s):
Threonyl-tRNA synthetase
Short name:
ThrRS
Threonyl-tRNA synthetase 1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TARS1Imported
Synonyms:TARS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11572 TARS1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
187790 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P26639

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi392Y → E: Partially restores in vitro translation. 1 Publication1
Mutagenesisi458F → A: Partially restores in vitro translation. 1 Publication1
Mutagenesisi462D → L: Does not restore in vitro translation, probably does not bind BN. 1 Publication1
Mutagenesisi567L → R or W: Does not restore in vitro translation, does not replace endogenous yeast enzyme. 1 Publication1
Mutagenesisi567L → V: Replaces endogenous yeast enzyme. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
6897

Open Targets

More...
OpenTargetsi
ENSG00000113407

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36337

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P26639

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3391

Drug and drug target database

More...
DrugBanki
DB00156 L-Threonine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TARS

Domain mapping of disease mutations (DMDM)

More...
DMDMi
60267755

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001011191 – 723Threonine--tRNA ligase 1, cytoplasmicAdd BLAST723

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei39PhosphoserineCombined sources1
Modified residuei243N6-acetyllysineCombined sources1
Modified residuei246PhosphothreonineCombined sources1
Modified residuei298PhosphotyrosineCombined sources1
Modified residuei453PhosphothreonineCombined sources1
Modified residuei702PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

ISGylated.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-1194
CPTAC-1195
CPTAC-278
CPTAC-279

Encyclopedia of Proteome Dynamics

More...
EPDi
P26639

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P26639

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P26639

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P26639

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P26639

PeptideAtlas

More...
PeptideAtlasi
P26639

PRoteomics IDEntifications database

More...
PRIDEi
P26639

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
3957
54357 [P26639-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P26639

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P26639

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P26639

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000113407 Expressed in 233 organ(s), highest expression level in adrenal tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P26639 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P26639 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA037425

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112760, 95 interactors

Protein interaction database and analysis system

More...
IntActi
P26639, 25 interactors

Molecular INTeraction database

More...
MINTi
P26639

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000387710

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P26639

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1723
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P26639

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P26639

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini79 – 143TGSPROSITE-ProRule annotationAdd BLAST65

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1637 Eukaryota
COG0441 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154969

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000003878

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P26639

KEGG Orthology (KO)

More...
KOi
K01868

Identification of Orthologs from Complete Genome Data

More...
OMAi
FYYDFAY

Database of Orthologous Groups

More...
OrthoDBi
813937at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P26639

TreeFam database of animal gene trees

More...
TreeFami
TF300858

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00771 ThrRS_core, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.20.30, 1 hit
3.40.50.800, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00184 Thr_tRNA_synth, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002314 aa-tRNA-synt_IIb
IPR006195 aa-tRNA-synth_II
IPR004154 Anticodon-bd
IPR036621 Anticodon-bd_dom_sf
IPR012675 Beta-grasp_dom_sf
IPR004095 TGS
IPR012676 TGS-like
IPR002320 Thr-tRNA-ligase_IIa
IPR018163 Thr/Ala-tRNA-synth_IIc_edit
IPR033728 ThrRS_core
IPR012947 tRNA_SAD

The PANTHER Classification System

More...
PANTHERi
PTHR11451 PTHR11451, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03129 HGTP_anticodon, 1 hit
PF02824 TGS, 1 hit
PF00587 tRNA-synt_2b, 1 hit
PF07973 tRNA_SAD, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01047 TRNASYNTHTHR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00863 tRNA_SAD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55186 SSF55186, 1 hit
SSF81271 SSF81271, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00418 thrS, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50862 AA_TRNA_LIGASE_II, 1 hit
PS51880 TGS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P26639-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFEEKASSPS GKMGGEEKPI GAGEEKQKEG GKKKNKEGSG DGGRAELNPW
60 70 80 90 100
PEYIYTRLEM YNILKAEHDS ILAEKAEKDS KPIKVTLPDG KQVDAESWKT
110 120 130 140 150
TPYQIACGIS QGLADNTVIA KVNNVVWDLD RPLEEDCTLE LLKFEDEEAQ
160 170 180 190 200
AVYWHSSAHI MGEAMERVYG GCLCYGPPIE NGFYYDMYLE EGGVSSNDFS
210 220 230 240 250
SLEALCKKII KEKQAFERLE VKKETLLAMF KYNKFKCRIL NEKVNTPTTT
260 270 280 290 300
VYRCGPLIDL CRGPHVRHTG KIKALKIHKN SSTYWEGKAD METLQRIYGI
310 320 330 340 350
SFPDPKMLKE WEKFQEEAKN RDHRKIGRDQ ELYFFHELSP GSCFFLPKGA
360 370 380 390 400
YIYNALIEFI RSEYRKRGFQ EVVTPNIFNS RLWMTSGHWQ HYSENMFSFE
410 420 430 440 450
VEKELFALKP MNCPGHCLMF DHRPRSWREL PLRLADFGVL HRNELSGALT
460 470 480 490 500
GLTRVRRFQQ DDAHIFCAME QIEDEIKGCL DFLRTVYSVF GFSFKLNLST
510 520 530 540 550
RPEKFLGDIE VWDQAEKQLE NSLNEFGEKW ELNSGDGAFY GPKIDIQIKD
560 570 580 590 600
AIGRYHQCAT IQLDFQLPIR FNLTYVSHDG DDKKRPVIVH RAILGSVERM
610 620 630 640 650
IAILTENYGG KWPFWLSPRQ VMVVPVGPTC DEYAQKVRQQ FHDAKFMADI
660 670 680 690 700
DLDPGCTLNK KIRNAQLAQY NFILVVGEKE KISGTVNIRT RDNKVHGERT
710 720
ISETIERLQQ LKEFRSKQAE EEF
Length:723
Mass (Da):83,435
Last modified:February 15, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i885745118972C5A9
GO
Isoform 2 (identifier: P26639-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-110: S → SHTASCKNLSSLASLLASVAIPSSGMPWPPLFFL

Show »
Length:756
Mass (Da):86,861
Checksum:iE3516F3A14CBC746
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6R9F8D6R9F8_HUMAN
Threonine--tRNA ligase 1, cytoplasm...
TARS1
129Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDJ6D6RDJ6_HUMAN
Threonine--tRNA ligase 1, cytoplasm...
TARS1
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RCA5D6RCA5_HUMAN
Threonine--tRNA ligase 1, cytoplasm...
TARS1
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBR8D6RBR8_HUMAN
Threonine--tRNA ligase 1, cytoplasm...
TARS1
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RJ97D6RJ97_HUMAN
Threonine--tRNA ligase 1, cytoplasm...
TARS1
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RCS6D6RCS6_HUMAN
Threonine--tRNA ligase 1, cytoplasm...
TARS1
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RHV7D6RHV7_HUMAN
Threonine--tRNA ligase 1, cytoplasm...
TARS1
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB04939 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti164A → G in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti350A → V in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti417C → S in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti439V → G in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti453T → I in AAH10578 (PubMed:15489334).Curated1
Sequence conflicti581D → E in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti612W → LA in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti636K → N in AAB04939 (PubMed:2033077).Curated1
Sequence conflicti683S → T in AAB04939 (PubMed:2033077).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03453321G → D. Corresponds to variant dbSNP:rs34334786Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045114110S → SHTASCKNLSSLASLLASVA IPSSGMPWPPLFFL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M63180 mRNA Translation: AAB04939.1 Different initiation.
AK292346 mRNA Translation: BAF85035.1
AK293620 mRNA Translation: BAG57079.1
AC025441 Genomic DNA No translation available.
AC034231 Genomic DNA No translation available.
CH471118 Genomic DNA Translation: EAX10804.1
BC000517 mRNA Translation: AAH00517.2
BC010578 mRNA Translation: AAH10578.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3899.1 [P26639-1]
CCDS58943.1 [P26639-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A38867 YSHUT

NCBI Reference Sequences

More...
RefSeqi
NP_001245366.1, NM_001258437.1 [P26639-1]
NP_001245367.1, NM_001258438.1 [P26639-2]
NP_689508.3, NM_152295.4 [P26639-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265112; ENSP00000265112; ENSG00000113407 [P26639-1]
ENST00000455217; ENSP00000387710; ENSG00000113407 [P26639-2]
ENST00000502553; ENSP00000424387; ENSG00000113407 [P26639-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6897

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6897

UCSC genome browser

More...
UCSCi
uc003jhy.5 human [P26639-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M63180 mRNA Translation: AAB04939.1 Different initiation.
AK292346 mRNA Translation: BAF85035.1
AK293620 mRNA Translation: BAG57079.1
AC025441 Genomic DNA No translation available.
AC034231 Genomic DNA No translation available.
CH471118 Genomic DNA Translation: EAX10804.1
BC000517 mRNA Translation: AAH00517.2
BC010578 mRNA Translation: AAH10578.2
CCDSiCCDS3899.1 [P26639-1]
CCDS58943.1 [P26639-2]
PIRiA38867 YSHUT
RefSeqiNP_001245366.1, NM_001258437.1 [P26639-1]
NP_001245367.1, NM_001258438.1 [P26639-2]
NP_689508.3, NM_152295.4 [P26639-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WWTNMR-A79-153[»]
4HWTX-ray2.30A/B321-723[»]
4P3NX-ray2.60A/B/C/D322-723[»]
4TTVX-ray2.80A/B/C/D322-723[»]
5XLNX-ray1.90B30-74[»]
SMRiP26639
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi112760, 95 interactors
IntActiP26639, 25 interactors
MINTiP26639
STRINGi9606.ENSP00000387710

Chemistry databases

BindingDBiP26639
ChEMBLiCHEMBL3391
DrugBankiDB00156 L-Threonine

Protein family/group databases

MoonProtiP26639

PTM databases

iPTMnetiP26639
PhosphoSitePlusiP26639
SwissPalmiP26639

Polymorphism and mutation databases

BioMutaiTARS
DMDMi60267755

Proteomic databases

CPTACiCPTAC-1194
CPTAC-1195
CPTAC-278
CPTAC-279
EPDiP26639
jPOSTiP26639
MassIVEiP26639
MaxQBiP26639
PaxDbiP26639
PeptideAtlasiP26639
PRIDEiP26639
ProteomicsDBi3957
54357 [P26639-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6897

Genome annotation databases

EnsembliENST00000265112; ENSP00000265112; ENSG00000113407 [P26639-1]
ENST00000455217; ENSP00000387710; ENSG00000113407 [P26639-2]
ENST00000502553; ENSP00000424387; ENSG00000113407 [P26639-1]
GeneIDi6897
KEGGihsa:6897
UCSCiuc003jhy.5 human [P26639-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6897
DisGeNETi6897

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TARS
HGNCiHGNC:11572 TARS1
HPAiHPA037425
MIMi187790 gene
neXtProtiNX_P26639
OpenTargetsiENSG00000113407
PharmGKBiPA36337

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1637 Eukaryota
COG0441 LUCA
GeneTreeiENSGT00940000154969
HOGENOMiHOG000003878
InParanoidiP26639
KOiK01868
OMAiFYYDFAY
OrthoDBi813937at2759
PhylomeDBiP26639
TreeFamiTF300858

Enzyme and pathway databases

BRENDAi6.1.1.3 2681
ReactomeiR-HSA-379716 Cytosolic tRNA aminoacylation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TARS human
EvolutionaryTraceiP26639

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TARS_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6897
PharosiP26639

Protein Ontology

More...
PROi
PR:P26639

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000113407 Expressed in 233 organ(s), highest expression level in adrenal tissue
ExpressionAtlasiP26639 baseline and differential
GenevisibleiP26639 HS

Family and domain databases

CDDicd00771 ThrRS_core, 1 hit
Gene3Di3.10.20.30, 1 hit
3.40.50.800, 1 hit
HAMAPiMF_00184 Thr_tRNA_synth, 1 hit
InterProiView protein in InterPro
IPR002314 aa-tRNA-synt_IIb
IPR006195 aa-tRNA-synth_II
IPR004154 Anticodon-bd
IPR036621 Anticodon-bd_dom_sf
IPR012675 Beta-grasp_dom_sf
IPR004095 TGS
IPR012676 TGS-like
IPR002320 Thr-tRNA-ligase_IIa
IPR018163 Thr/Ala-tRNA-synth_IIc_edit
IPR033728 ThrRS_core
IPR012947 tRNA_SAD
PANTHERiPTHR11451 PTHR11451, 1 hit
PfamiView protein in Pfam
PF03129 HGTP_anticodon, 1 hit
PF02824 TGS, 1 hit
PF00587 tRNA-synt_2b, 1 hit
PF07973 tRNA_SAD, 1 hit
PRINTSiPR01047 TRNASYNTHTHR
SMARTiView protein in SMART
SM00863 tRNA_SAD, 1 hit
SUPFAMiSSF55186 SSF55186, 1 hit
SSF81271 SSF81271, 1 hit
TIGRFAMsiTIGR00418 thrS, 1 hit
PROSITEiView protein in PROSITE
PS50862 AA_TRNA_LIGASE_II, 1 hit
PS51880 TGS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSYTC_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P26639
Secondary accession number(s): A8K8I1
, B4DEG8, Q96FP5, Q9BWA6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 1, 1992
Last sequence update: February 15, 2005
Last modified: October 16, 2019
This is version 213 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Aminoacyl-tRNA synthetases
    List of aminoacyl-tRNA synthetase entries
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again