Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 220 (31 Jul 2019)
Sequence version 4 (13 Feb 2019)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Focal adhesion kinase 1

Gene

Ptk2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 9 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription (By similarity).By similarity17 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Subject to autoinhibition, mediated by interactions between the FERM domain and the kinase domain. Activated by autophosphorylation at Tyr-397. This promotes interaction with SRC and phosphorylation at Tyr-576 and Tyr-577 in the kinase activation loop by SRC. Phosphorylation at Tyr-397, Tyr-576 and Tyr-577 is required for maximal kinase activity.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei454ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei546Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi428 – 434ATPPROSITE-ProRule annotation7
Nucleotide bindingi500 – 502ATPPROSITE-ProRule annotation3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Kinase, Transferase, Tyrosine-protein kinase
Biological processAngiogenesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.10.2 3474

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-111465 Apoptotic cleavage of cellular proteins
R-MMU-2029482 Regulation of actin dynamics for phagocytic cup formation
R-MMU-354192 Integrin alphaIIb beta3 signaling
R-MMU-354194 GRB2:SOS provides linkage to MAPK signaling for Integrins
R-MMU-372708 p130Cas linkage to MAPK signaling for integrins
R-MMU-375165 NCAM signaling for neurite out-growth
R-MMU-3928662 EPHB-mediated forward signaling
R-MMU-418885 DCC mediated attractive signaling
R-MMU-4420097 VEGFA-VEGFR2 Pathway
R-MMU-5663213 RHO GTPases Activate WASPs and WAVEs
R-MMU-5673001 RAF/MAP kinase cascade
R-MMU-8874081 MET activates PTK2 signaling
R-MMU-9009391 Non-genomic estrogen signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Focal adhesion kinase 1 (EC:2.7.10.2)
Short name:
FADK 1
Alternative name(s):
Focal adhesion kinase-related nonkinase
Short name:
FRNK
Protein-tyrosine kinase 2
p125FAK
pp125FAK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ptk2
Synonyms:Fadk, Fak, Fak1, Kiaa4203
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:95481 Ptk2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Embryonically lethal. Embryos die at about 8.5 dpc, despite normal implantation. Embryos do not develop a normal head fold, neural tube or heart tube. Endothelial-specific gene disruption is lethal at about 11 dpc, due to defects in embryonic angiogenesis.4 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi397Y → F: Strongly reduced enzyme activity; when associated with 576-F-F-577. Abolishes activation of MAPK1/ERK2 in response to integrin signaling. Abolishes activation of SRC. Abolishes interaction with PIK3R1. 3 Publications1
Mutagenesisi576 – 577YY → FF: Strongly reduced enzyme activity; when associated with F-397. 2 Publications2
Mutagenesisi925Y → F: Abolishes interaction with GRB2. 2 Publications1
Mutagenesisi1034L → S: Loss of interaction with ARHGEF28. 1 Publication1

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1075288

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000880782 – 1052Focal adhesion kinase 1Add BLAST1051

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanine1 Publication1
Modified residuei5PhosphotyrosineBy similarity1
Modified residuei13PhosphothreonineBy similarity1
Modified residuei29PhosphoserineBy similarity1
Modified residuei54PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki152Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
Modified residuei397Phosphotyrosine; by autocatalysisCombined sources5 Publications1
Modified residuei407Phosphotyrosine2 Publications1
Modified residuei570PhosphotyrosineBy similarity1
Modified residuei576Phosphotyrosine; by RET and SRCCombined sources3 Publications1
Modified residuei577Phosphotyrosine; by RET and SRCCombined sources3 Publications1
Modified residuei580PhosphoserineBy similarity1
Modified residuei722PhosphoserineBy similarity1
Modified residuei732Phosphoserine; by CDK51 Publication1
Modified residuei843PhosphoserineBy similarity1
Modified residuei861Phosphotyrosine1 Publication1
Modified residuei910Phosphoserine1 Publication1
Modified residuei914PhosphothreonineBy similarity1
Modified residuei925Phosphotyrosine; by SRCCombined sources4 Publications1
Isoform 4 (identifier: P34152-4)
Modified residuei397PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine residues upon activation, e.g. upon integrin signaling. Tyr-397 is the major autophosphorylation site, but other kinases can also phosphorylate this residue. Phosphorylation at Tyr-397 promotes interaction with SRC and SRC family members, leading to phosphorylation at Tyr-576, Tyr-577 and at additional tyrosine residues. FGR promotes phosphorylation at Tyr-397 and Tyr-576. FER promotes phosphorylation at Tyr-577, Tyr-861 and Tyr-925, even when cells are not adherent. Tyr-397, Tyr-576 and Ser-722 are phosphorylated only when cells are adherent. Phosphorylation at Tyr-397 is important for interaction with BMX, PIK3R1 and SHC1. Phosphorylation at Tyr-925 is important for interaction with GRB2. Dephosphorylated by PTPN11; PTPN11 is recruited to PTK2 via EPHA2 (tyrosine phosphorylated). Microtubule-induced dephosphorylation at Tyr-397 is crucial for the induction of focal adhesion disassembly; this dephosphorylation could be catalyzed by PTPN11 and regulated by ZFYVE21. Phosphorylation on tyrosine residues is enhanced by NTN1 (PubMed:22685302).13 Publications
Sumoylated; this enhances autophosphorylation.By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P34152

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P34152

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P34152

PeptideAtlas

More...
PeptideAtlasi
P34152

PRoteomics IDEntifications database

More...
PRIDEi
P34152

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P34152

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P34152

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P34152

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 9 is detected in neonate myocardium; levels are low directly after birth, high five to fifteen days after birth, and not detectable in adult (at protein level). Isoform 9 is detected in neonate myocardium; levels are high directly after birth, decrease during the first week of life and are low thereafter.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022607 Expressed in 316 organ(s), highest expression level in brain blood vessel

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P34152 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P34152 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GIT1.

Component of a complex that contains at least FER, CTTN and PTK2/FAK1.

Interacts with BMX.

Interacts with STEAP4.

Interacts with ZFYVE21.

Interacts with ESR1.

Interacts with FGR, FLT4 and RET.

Interacts with EPHA2 in resting cells; activation of EPHA2 recruits PTPN11, leading to dephosphorylation of PTK2/FAK1 and dissociation of the complex.

Interacts with EPHA1 (kinase activity-dependent) (By similarity).

Interacts with MISP (By similarity).

Interacts with PIAS1.

Interacts with ARHGAP26 and SHC1.

Interacts with RB1CC1; this inhibits PTK2/FAK1 activity and activation of downstream signaling pathways.

Interacts with P53/TP53.

Interacts with STAT1.

Interacts with WASL.

Interacts with ARHGEF7.

Interacts with DCC.

Interacts (via first Pro-rich region) with CAS family members (via SH3 domain), including BCAR1, BCAR3, CASS4 and NEDD9.

Interacts with SORBS1.

Interacts with ARHGEF28.

Interacts with SHB.

Interacts with PXN and TLN1.

Interacts with TGFB1I1.

Interacts with PIK3R1 or PIK3R2.

Interacts with SRC, GRB2 and GRB7.

Interacts with LPXN (via LD motif 3).

Interacts with CD36.

Interacts with EMP2; regulates PTK2 activation and localization (By similarity).

Interacts with DSCAM (PubMed:22685302).

By similarity23 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
199587, 18 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P34152

Database of interacting proteins

More...
DIPi
DIP-31045N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P34152

Protein interaction database and analysis system

More...
IntActi
P34152, 24 interactors

Molecular INTeraction database

More...
MINTi
P34152

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000105663

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11052
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P34152

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P34152

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 355FERMPROSITE-ProRule annotationAdd BLAST321
Domaini431 – 680Protein kinasePROSITE-ProRule annotationAdd BLAST250

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni707 – 1052Interaction with TGFB1I1By similarityAdd BLAST346
Regioni912 – 1052Interaction with ARHGEF281 PublicationAdd BLAST141

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi712 – 733Pro-richAdd BLAST22
Compositional biasi863 – 913Pro-richAdd BLAST51

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The first Pro-rich domain interacts with the SH3 domain of CAS family members, such as BCAR1 and NEDD9.
The C-terminal region is the site of focal adhesion targeting (FAT) sequence which mediates the localization of FAK1 to focal adhesions.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. FAK subfamily.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4257 Eukaryota
ENOG410ZH9Y LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155113

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P34152

KEGG Orthology (KO)

More...
KOi
K05725

Identification of Orthologs from Complete Genome Data

More...
OMAi
HYFENSS

Database of Orthologous Groups

More...
OrthoDBi
43729at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P34152

TreeFam database of animal gene trees

More...
TreeFami
TF316643

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14473 FERM_B-lobe, 1 hit
cd13190 FERM_C_FAK1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.80.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019749 Band_41_domain
IPR041390 FADK_N
IPR041784 FAK1/PYK2_FERM_C
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR000299 FERM_domain
IPR036137 Focal_adhe_kin_target_dom_sf
IPR005189 Focal_adhesion_kin_target_dom
IPR011009 Kinase-like_dom_sf
IPR011993 PH-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR008266 Tyr_kinase_AS
IPR020635 Tyr_kinase_cat_dom
IPR029071 Ubiquitin-like_domsf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00373 FERM_M, 1 hit
PF18038 FERM_N_2, 1 hit
PF03623 Focal_AT, 1 hit
PF07714 Pkinase_Tyr, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00109 TYRKINASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00295 B41, 1 hit
SM00219 TyrKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47031 SSF47031, 1 hit
SSF54236 SSF54236, 1 hit
SSF56112 SSF56112, 1 hit
SSF68993 SSF68993, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00109 PROTEIN_KINASE_TYR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: P34152-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAYLDPNL NHTPSSSTKT HLGTGMERSP GAMERVLKVF HYFESSSEPT
60 70 80 90 100
TWASIIRHGD ATDVRGIIQK IVDSHKVKHV ACYGFRLSHL RSEEVHWLHV
110 120 130 140 150
DMGVSSVREK YELAHPPEEW KYELRIRYLP KGFLNQFTED KPTLNFFYQQ
160 170 180 190 200
VKSDYMQEIA DQVDQEIALK LGCLEIRRSY WEMRGNALEK KSNYEVLEKD
210 220 230 240 250
VGLKRFFPKS LLDSVKAKTL RKLIQQTFRQ FANLNREESI LKFFEILSPV
260 270 280 290 300
YRFDKECFKC ALGSSWIISV ELAIGPEEGI SYLTDKGCNP THLADFNQVQ
310 320 330 340 350
TIQYSNSEDK DRKGMLQLKI AGAPEPLTVT APSLTIAENM ADLIDGYCRL
360 370 380 390 400
VNGATQSFII RPQKEGERAL PSIPKLANSE KQGMRTHAVS VSETDDYAEI
410 420 430 440 450
IDEEDTYTMP STRDYEIQRE RIELGRCIGE GQFGDVHQGV YLSPENPALA
460 470 480 490 500
VAIKTCKNCT SDSVREKFLQ EALTMRQFDH PHIVKLIGVI TENPVWIIME
510 520 530 540 550
LCTLGELRSF LQVRKYSLDL ASLILYAYQL STALAYLESK RFVHRDIAAR
560 570 580 590 600
NVLVSSNDCV KLGDFGLSRY MEDSTYYKAS KGKLPIKWMA PESINFRRFT
610 620 630 640 650
SASDVWMFGV CMWEILMHGV KPFQGVKNND VIGRIENGER LPMPPNCPPT
660 670 680 690 700
LYSLMTKCWA YDPSRRPRFT ELKAQLSTIL EEEKVQQEER MRMESRRQAT
710 720 730 740 750
VSWDSGGSDE APPKPSRPGY PSPRSSEGFY PSPQHMVQTN HYQVSGYPGS
760 770 780 790 800
HGIPAMAGSI YQGQASLLDQ TELWNHRPQE MSMWQPSVED SAALDLRGMG
810 820 830 840 850
QVLPPHLMEE RLIRQQQEME EDQRWLEKEE RFLKPDVRLS RGSIDREDGS
860 870 880 890 900
FQGPTGNQHI YQPVGKPDPA APPKKPPRPG APGHLSNLSS ISSPADSYNE
910 920 930 940 950
GVKLQPQEIS PPPTANLDRS NDKVYENVTG LVKAVIEMSS KIQPAPPEEY
960 970 980 990 1000
VPMVKEVGLA LRTLLATVDE TIPALPASTH REIEMAQKLL NSDLGELISK
1010 1020 1030 1040 1050
MKLAQQYVMT SLQQEYKKQM LTAAHALAVD AKNLLDVIDQ ARLKMLGQTR

PH
Length:1,052
Mass (Da):119,243
Last modified:February 13, 2019 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4B7453C5D81F0F63
GO
Isoform 2 (identifier: P34152-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-392: S → SHCQHKVKKARRFLPLVFCSLEPPPTDEISGD

Show »
Length:1,083
Mass (Da):122,774
Checksum:iE536A38627B90A83
GO
Isoform 4 (identifier: P34152-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     903-903: K → KPWR

Note: No experimental confirmation available.Combined sources
Show »
Length:1,055
Mass (Da):119,682
Checksum:iAFB79846FA73ED6F
GO
Isoform 5 (identifier: P34152-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-392: S → SGVSHCQHKVKKARRFLPLVFCSLEPPPTDEISGD
     412-412: T → KSYGIDEA
     904-916: LQPQEISPPPTAN → VGICACAMWSVPC
     917-1052: Missing.

Show »
Length:957
Mass (Da):108,608
Checksum:iD277A4D65AE6012A
GO
Isoform 6 (identifier: P34152-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     904-916: LQPQEISPPPTAN → VGICACAMWSVPC
     917-1052: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:916
Mass (Da):104,070
Checksum:iF2DA51E8CC785229
GO
Isoform 7 (identifier: P34152-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-392: S → SDEISGD
     412-412: T → KSYGIDEA
     473-496: LTMRQFDHPHIVKLIGVITENPVW → SEVIFASKKIQLGPGIFDIICLSA
     497-1052: Missing.

Note: No experimental confirmation available.
Show »
Length:509
Mass (Da):57,697
Checksum:iA406369629607D5D
GO
Isoform 8 (identifier: P34152-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     199-1052: Missing.

Note: No experimental confirmation available.
Show »
Length:198
Mass (Da):23,064
Checksum:i2732777636068833
GO
Isoform 9 (identifier: P34152-9) [UniParc]FASTAAdd to basket
Also known as: FRNK

The sequence of this isoform differs from the canonical sequence as follows:
     1-692: Missing.

Note: Produced by alternative promoter usage.
Show »
Length:360
Mass (Da):39,930
Checksum:i6C5E4C5486C62265
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2I3BQ85A0A2I3BQ85_MOUSE
Focal adhesion kinase 1
Ptk2
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BPK4A0A2I3BPK4_MOUSE
Focal adhesion kinase 1
Ptk2
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q2VQT9Q2VQT9_MOUSE
Focal adhesion kinase
Ptk2 Fak
14Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BRG7A0A2I3BRG7_MOUSE
Focal adhesion kinase 1
Ptk2
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BR46A0A2I3BR46_MOUSE
Focal adhesion kinase 1
Ptk2
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC37757 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAD90317 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
Isoform 6 : The sequence BC030180 differs from that shown. a stop codon in position 912 which was translated as Trp to extend the sequenceCurated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti32A → T in BC030180 (PubMed:15489334).Curated1
Sequence conflicti42Y → H in AAA37592 (PubMed:1528852).Curated1
Sequence conflicti87L → V in BAB24058 (PubMed:16141072).Curated1
Sequence conflicti128Y → D in BAB24058 (PubMed:16141072).Curated1
Sequence conflicti146F → V in BAB24058 (PubMed:16141072).Curated1
Sequence conflicti157Q → L in BC030180 (PubMed:15489334).Curated1
Sequence conflicti225Q → H in BAC37757 (PubMed:16141072).Curated1
Sequence conflicti250V → M in BAC37757 (PubMed:16141072).Curated1
Sequence conflicti762Q → P in BC030180 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0600341 – 692Missing in isoform 9. Add BLAST692
Alternative sequenceiVSP_060035199 – 1052Missing in isoform 8. Add BLAST854
Alternative sequenceiVSP_060036392S → SHCQHKVKKARRFLPLVFCS LEPPPTDEISGD in isoform 2. 1
Alternative sequenceiVSP_060037392S → SGVSHCQHKVKKARRFLPLV FCSLEPPPTDEISGD in isoform 5. 1
Alternative sequenceiVSP_060038392S → SDEISGD in isoform 7. 1
Alternative sequenceiVSP_060039412T → KSYGIDEA in isoform 5 and isoform 7. 1
Alternative sequenceiVSP_060040473 – 496LTMRQ…ENPVW → SEVIFASKKIQLGPGIFDII CLSA in isoform 7. Add BLAST24
Alternative sequenceiVSP_060041497 – 1052Missing in isoform 7. Add BLAST556
Alternative sequenceiVSP_060042903K → KPWR in isoform 4. 1
Alternative sequenceiVSP_060043904 – 916LQPQE…PPTAN → VGICACAMWSVPC in isoform 5 and isoform 6. Add BLAST13
Alternative sequenceiVSP_060044917 – 1052Missing in isoform 5 and isoform 6. Add BLAST136

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M95408 mRNA Translation: AAA37592.1
AB030035 mRNA Translation: BAC53924.1
AB011499 mRNA Translation: BAC53890.1
AK005468 mRNA Translation: BAB24058.1
AK079821 mRNA Translation: BAC37757.1 Different initiation.
AK220543 mRNA Translation: BAD90317.1 Different initiation.
BC030180 mRNA No translation available.
AH005806 Genomic DNA Translation: AAB95262.1
AH005806 Genomic DNA Translation: AAB95263.1
U77074 Genomic DNA Translation: AAB51229.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS37099.1 [P34152-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A46166

NCBI Reference Sequences

More...
RefSeqi
NP_001123881.1, NM_001130409.1
NP_032008.2, NM_007982.2 [P34152-3]
XP_006520496.1, XM_006520433.2 [P34152-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000110036; ENSMUSP00000105663; ENSMUSG00000022607 [P34152-3]
ENSMUST00000226988; ENSMUSP00000154242; ENSMUSG00000022607 [P34152-4]
ENSMUST00000228180; ENSMUSP00000155470; ENSMUSG00000022607 [P34152-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
14083

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:14083

UCSC genome browser

More...
UCSCi
uc007wbw.2 mouse [P34152-4]
uc007wbx.2 mouse [P34152-3]
uc007wby.2 mouse [P34152-5]
uc007wbz.2 mouse [P34152-6]
uc007wca.1 mouse [P34152-8]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M95408 mRNA Translation: AAA37592.1
AB030035 mRNA Translation: BAC53924.1
AB011499 mRNA Translation: BAC53890.1
AK005468 mRNA Translation: BAB24058.1
AK079821 mRNA Translation: BAC37757.1 Different initiation.
AK220543 mRNA Translation: BAD90317.1 Different initiation.
BC030180 mRNA No translation available.
AH005806 Genomic DNA Translation: AAB95262.1
AH005806 Genomic DNA Translation: AAB95263.1
U77074 Genomic DNA Translation: AAB51229.1
CCDSiCCDS37099.1 [P34152-3]
PIRiA46166
RefSeqiNP_001123881.1, NM_001130409.1
NP_032008.2, NM_007982.2 [P34152-3]
XP_006520496.1, XM_006520433.2 [P34152-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K40X-ray2.25A921-1046[»]
1KKYmodel-B921-1046[»]
1KL0model-A921-1046[»]
5F28X-ray2.90E/F/G904-1052[»]
6BZ3X-ray2.50A/C921-1046[»]
SMRiP34152
ModBaseiSearch...

Protein-protein interaction databases

BioGridi199587, 18 interactors
CORUMiP34152
DIPiDIP-31045N
ELMiP34152
IntActiP34152, 24 interactors
MINTiP34152
STRINGi10090.ENSMUSP00000105663

Chemistry databases

ChEMBLiCHEMBL1075288

PTM databases

iPTMnetiP34152
PhosphoSitePlusiP34152
SwissPalmiP34152

Proteomic databases

jPOSTiP34152
MaxQBiP34152
PaxDbiP34152
PeptideAtlasiP34152
PRIDEiP34152

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000110036; ENSMUSP00000105663; ENSMUSG00000022607 [P34152-3]
ENSMUST00000226988; ENSMUSP00000154242; ENSMUSG00000022607 [P34152-4]
ENSMUST00000228180; ENSMUSP00000155470; ENSMUSG00000022607 [P34152-8]
GeneIDi14083
KEGGimmu:14083
UCSCiuc007wbw.2 mouse [P34152-4]
uc007wbx.2 mouse [P34152-3]
uc007wby.2 mouse [P34152-5]
uc007wbz.2 mouse [P34152-6]
uc007wca.1 mouse [P34152-8]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5747
MGIiMGI:95481 Ptk2

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG4257 Eukaryota
ENOG410ZH9Y LUCA
GeneTreeiENSGT00940000155113
InParanoidiP34152
KOiK05725
OMAiHYFENSS
OrthoDBi43729at2759
PhylomeDBiP34152
TreeFamiTF316643

Enzyme and pathway databases

BRENDAi2.7.10.2 3474
ReactomeiR-MMU-111465 Apoptotic cleavage of cellular proteins
R-MMU-2029482 Regulation of actin dynamics for phagocytic cup formation
R-MMU-354192 Integrin alphaIIb beta3 signaling
R-MMU-354194 GRB2:SOS provides linkage to MAPK signaling for Integrins
R-MMU-372708 p130Cas linkage to MAPK signaling for integrins
R-MMU-375165 NCAM signaling for neurite out-growth
R-MMU-3928662 EPHB-mediated forward signaling
R-MMU-418885 DCC mediated attractive signaling
R-MMU-4420097 VEGFA-VEGFR2 Pathway
R-MMU-5663213 RHO GTPases Activate WASPs and WAVEs
R-MMU-5673001 RAF/MAP kinase cascade
R-MMU-8874081 MET activates PTK2 signaling
R-MMU-9009391 Non-genomic estrogen signaling

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ptk2 mouse
EvolutionaryTraceiP34152

Protein Ontology

More...
PROi
PR:P34152

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022607 Expressed in 316 organ(s), highest expression level in brain blood vessel
ExpressionAtlasiP34152 baseline and differential
GenevisibleiP34152 MM

Family and domain databases

CDDicd14473 FERM_B-lobe, 1 hit
cd13190 FERM_C_FAK1, 1 hit
Gene3Di1.20.80.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR019749 Band_41_domain
IPR041390 FADK_N
IPR041784 FAK1/PYK2_FERM_C
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR000299 FERM_domain
IPR036137 Focal_adhe_kin_target_dom_sf
IPR005189 Focal_adhesion_kin_target_dom
IPR011009 Kinase-like_dom_sf
IPR011993 PH-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR008266 Tyr_kinase_AS
IPR020635 Tyr_kinase_cat_dom
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00373 FERM_M, 1 hit
PF18038 FERM_N_2, 1 hit
PF03623 Focal_AT, 1 hit
PF07714 Pkinase_Tyr, 1 hit
PRINTSiPR00109 TYRKINASE
SMARTiView protein in SMART
SM00295 B41, 1 hit
SM00219 TyrKc, 1 hit
SUPFAMiSSF47031 SSF47031, 1 hit
SSF54236 SSF54236, 1 hit
SSF56112 SSF56112, 1 hit
SSF68993 SSF68993, 1 hit
PROSITEiView protein in PROSITE
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00109 PROTEIN_KINASE_TYR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFAK1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P34152
Secondary accession number(s): O08578
, Q5DTH7, Q8C513, Q8CFH7, Q8CHM2, Q8K2S0, Q9DAW3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 13, 2019
Last modified: July 31, 2019
This is version 220 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  4. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again