Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 223 (03 Jul 2019)
Sequence version 1 (01 Feb 1994)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Merlin

Gene

NF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway. May act as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. Suppresses cell proliferation and tumorigenesis by inhibiting the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-5627123 RHO GTPases activate PAKs

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P35240

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P35240

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Merlin
Alternative name(s):
Moesin-ezrin-radixin-like protein
Neurofibromin-2
Schwannomerlin
Schwannomin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NF2
Synonyms:SCH
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7773 NF2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607379 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P35240

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Neurofibromatosis 2 (NF2)14 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionGenetic disorder characterized by bilateral vestibular schwannomas (formerly called acoustic neuromas), schwannomas of other cranial and peripheral nerves, meningiomas, and ependymomas. It is inherited in an autosomal dominant fashion with full penetrance. Affected individuals generally develop symptoms of eighth-nerve dysfunction in early adulthood, including deafness and balance disorder. Although the tumors of NF2 are histologically benign, their anatomic location makes management difficult, and patients suffer great morbidity and mortality.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_00081062F → S in NF2; loss of ability to interact with the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. 4 PublicationsCorresponds to variant dbSNP:rs121434261EnsemblClinVar.1
Natural variantiVAR_04301177M → V in NF2. 1 Publication1
Natural variantiVAR_00081296Missing in NF2; also found in sporadic meningioma. 2 Publications1
Natural variantiVAR_000813106E → G in NF2. 2 Publications1
Natural variantiVAR_065227133C → R in NF2. 1 Publication1
Natural variantiVAR_043012141L → P in NF2; loss of ability to interact with the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. 2 Publications1
Natural variantiVAR_043013197G → C in NF2. 1 Publication1
Natural variantiVAR_000818220N → Y in NF2. 1 Publication1
Natural variantiVAR_009123234L → R in NF2; also found in retinal hamartoma; severe. 1 Publication1
Natural variantiVAR_000821352T → M in NF2. 2 PublicationsCorresponds to variant dbSNP:rs764441073Ensembl.1
Natural variantiVAR_000822360L → P in NF2. Corresponds to variant dbSNP:rs74315492EnsemblClinVar.1
Natural variantiVAR_043014413K → E in NF2. 2 PublicationsCorresponds to variant dbSNP:rs766974263Ensembl.1
Natural variantiVAR_043015533K → T in NF2. 1 Publication1
Natural variantiVAR_000825535L → P in NF2; late onset. 3 PublicationsCorresponds to variant dbSNP:rs74315493EnsemblClinVar.1
Natural variantiVAR_000826538Q → P in NF2; mild. 1 PublicationCorresponds to variant dbSNP:rs74315494EnsemblClinVar.1
Natural variantiVAR_043016539L → H in NF2. 1 Publication1
Natural variantiVAR_043017579K → M in NF2. 1 Publication1
Schwannomatosis 1 (SWNTS1)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA cancer syndrome in which patients develop multiple non-vestibular schwannomas, benign neoplasms that arise from Schwann cells of the cranial, peripheral, and autonomic nerves.
Related information in OMIM
Mesothelioma, malignant (MESOM)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry.
Disease descriptionAn aggressive neoplasm of the serosal lining of the chest. It appears as broad sheets of cells, with some regions containing spindle-shaped, sarcoma-like cells and other regions showing adenomatous patterns. Pleural mesotheliomas have been linked to exposure to asbestos.
Related information in OMIM

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi64L → P: Abolishes binding to AGAP2 and interaction with the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. 2 Publications1
Mutagenesisi518S → A: Loss of phosphorylation. Significant accumulation in the nucleus and no effect on binding to DCAF1. 1 Publication1
Mutagenesisi518S → D: No effect on phosphorylation. Defective nuclear accumulation. Significant decrease in binding to DCAF1 and in ability to inhibit cell proliferation. 1 Publication1

Keywords - Diseasei

Deafness, Disease mutation, Tumor suppressor

Organism-specific databases

DisGeNET

More...
DisGeNETi
4771

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
NF2

MalaCards human disease database

More...
MalaCardsi
NF2
MIMi101000 phenotype
156240 phenotype
162091 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000186575

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
637 Neurofibromatosis type 2
93921 Neurofibromatosis type 3

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31580

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NF2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
462594

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002194121 – 595MerlinAdd BLAST595

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei13PhosphoserineCombined sources1
Modified residuei518Phosphoserine; by PAKCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation of Ser-518 inhibits nuclear localization by disrupting the intramolecular association of the FERM domain with the C-terminal tail (PubMed:20178741). The dephosphorylation of Ser-518 favors the interaction with NOP53 (PubMed:21167305).2 Publications
Ubiquitinated by the CUL4A-RBX1-DDB1-DCAF1/VprBP E3 ubiquitin-protein ligase complex for ubiquitination and subsequent proteasome-dependent degradation.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P35240

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P35240

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P35240

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P35240

PeptideAtlas

More...
PeptideAtlasi
P35240

PRoteomics IDEntifications database

More...
PRIDEi
P35240

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54999
55000 [P35240-10]
55001 [P35240-2]
55002 [P35240-3]
55003 [P35240-4]
55004 [P35240-5]
55005 [P35240-6]
55006 [P35240-7]
55007 [P35240-8]
55008 [P35240-9]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
P35240

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P35240

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P35240

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P35240

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Isoform 1 and isoform 3 are predominant. Isoform 4, isoform 5 and isoform 6 are expressed moderately. Isoform 8 is found at low frequency. Isoform 7, isoform 9 and isoform 10 are not expressed in adult tissues, with the exception of adult retina expressing isoform 10. Isoform 9 is faintly expressed in fetal brain, heart, lung, skeletal muscle and spleen. Fetal thymus expresses isoforms 1, 7, 9 and 10 at similar levels.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186575 Expressed in 219 organ(s), highest expression level in smooth muscle tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P35240 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P35240 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB005385
HPA003097

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SLC9A3R1, HGS and AGAP2.

Interacts with LAYN (By similarity).

Interacts with SGSM3.

Interacts (via FERM domain) with MPP1.

Interacts with WWC1.

Interacts with the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. The unphosphorylated form interacts (via FERM domain) with VPRBP/DCAF1.

Interacts (via FERM domain) with NOP53; the interaction is direct (PubMed:21167305).

Interacts with SCHIP1; the interaction is direct (PubMed:10669747).

By similarity10 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110844, 258 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P35240

Database of interacting proteins

More...
DIPi
DIP-35389N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P35240

Protein interaction database and analysis system

More...
IntActi
P35240, 46 interactors

Molecular INTeraction database

More...
MINTi
P35240

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000344666

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1595
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P35240

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P35240

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini22 – 311FERMPROSITE-ProRule annotationAdd BLAST290

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi327 – 465Glu-richAdd BLAST139

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3529 Eukaryota
ENOG410XQFP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00960000186596

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P35240

KEGG Orthology (KO)

More...
KOi
K16684

Identification of Orthologs from Complete Genome Data

More...
OMAi
ACYAEHR

Database of Orthologous Groups

More...
OrthoDBi
627741at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P35240

TreeFam database of animal gene trees

More...
TreeFami
TF313935

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14473 FERM_B-lobe, 1 hit
cd13194 FERM_C_ERM, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.80.10, 1 hit
1.25.40.1020, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019749 Band_41_domain
IPR011174 ERM
IPR011259 ERM_C_dom
IPR041789 ERM_FERM_C
IPR000798 Ez/rad/moesin-like
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR008954 Moesin_tail_sf
IPR011993 PH-like_dom_sf
IPR029071 Ubiquitin-like_domsf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00769 ERM, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF002305 ERM, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00935 BAND41
PR00661 ERMFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00295 B41, 1 hit
SM01196 FERM_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47031 SSF47031, 1 hit
SSF48678 SSF48678, 1 hit
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00660 FERM_1, 1 hit
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P35240-1) [UniParc]FASTAAdd to basket
Also known as: I

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGAIASRMS FSSLKRKQPK TFTVRIVTMD AEMEFNCEMK WKGKDLFDLV
60 70 80 90 100
CRTLGLRETW FFGLQYTIKD TVAWLKMDKK VLDHDVSKEE PVTFHFLAKF
110 120 130 140 150
YPENAEEELV QEITQHLFFL QVKKQILDEK IYCPPEASVL LASYAVQAKY
160 170 180 190 200
GDYDPSVHKR GFLAQEELLP KRVINLYQMT PEMWEERITA WYAEHRGRAR
210 220 230 240 250
DEAEMEYLKI AQDLEMYGVN YFAIRNKKGT ELLLGVDALG LHIYDPENRL
260 270 280 290 300
TPKISFPWNE IRNISYSDKE FTIKPLDKKI DVFKFNSSKL RVNKLILQLC
310 320 330 340 350
IGNHDLFMRR RKADSLEVQQ MKAQAREEKA RKQMERQRLA REKQMREEAE
360 370 380 390 400
RTRDELERRL LQMKEEATMA NEALMRSEET ADLLAEKAQI TEEEAKLLAQ
410 420 430 440 450
KAAEAEQEMQ RIKATAIRTE EEKRLMEQKV LEAEVLALKM AEESERRAKE
460 470 480 490 500
ADQLKQDLQE AREAERRAKQ KLLEIATKPT YPPMNPIPAP LPPDIPSFNL
510 520 530 540 550
IGDSLSFDFK DTDMKRLSME IEKEKVEYME KSKHLQEQLN ELKTEIEALK
560 570 580 590
LKERETALDI LHNENSDRGG SSKHNTIKKL TLQSAKSRVA FFEEL
Length:595
Mass (Da):69,690
Last modified:February 1, 1994 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB1A1BF2BD5DA561C
GO
Isoform 2 (identifier: P35240-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-595: LTLQSAKSRVAFFEEL → SSPRQKTYLHLSPQSRLFPGTLYVVMLYVVMVLPSVILTRA

Show »
Length:620
Mass (Da):72,514
Checksum:i6A462A3A113A6C28
GO
Isoform 3 (identifier: P35240-3) [UniParc]FASTAAdd to basket
Also known as: II

The sequence of this isoform differs from the canonical sequence as follows:
     580-590: LTLQSAKSRVA → PQAQGRRPICI
     591-595: Missing.

Show »
Length:590
Mass (Da):69,090
Checksum:i99B732B48367D22A
GO
Isoform 4 (identifier: P35240-4) [UniParc]FASTAAdd to basket
Also known as: delE2/3

The sequence of this isoform differs from the canonical sequence as follows:
     39-121: Missing.
     580-590: LTLQSAKSRVA → PQAQGRRPICI
     591-595: Missing.

Show »
Length:507
Mass (Da):59,096
Checksum:iDD8162ABBC9EA4CA
GO
Isoform 5 (identifier: P35240-5) [UniParc]FASTAAdd to basket
Also known as: delE3

The sequence of this isoform differs from the canonical sequence as follows:
     81-121: Missing.
     580-590: LTLQSAKSRVA → PQAQGRRPICI
     591-595: Missing.

Show »
Length:549
Mass (Da):64,189
Checksum:i905559E6F72D3F4C
GO
Isoform 6 (identifier: P35240-6) [UniParc]FASTAAdd to basket
Also known as: delE2

The sequence of this isoform differs from the canonical sequence as follows:
     39-80: Missing.
     580-590: LTLQSAKSRVA → PQAQGRRPICI
     591-595: Missing.

Show »
Length:548
Mass (Da):63,996
Checksum:i58E15B35515C10EE
GO
Isoform 7 (identifier: P35240-7) [UniParc]FASTAAdd to basket
Also known as: MER150

The sequence of this isoform differs from the canonical sequence as follows:
     259-259: N → R
     260-595: Missing.

Show »
Length:259
Mass (Da):30,454
Checksum:i3C7B9CDBC884CDF6
GO
Isoform 8 (identifier: P35240-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     335-363: Missing.
     580-590: LTLQSAKSRVA → PQAQGRRPICI
     591-595: Missing.

Show »
Length:561
Mass (Da):65,350
Checksum:i371C417ABDB68D02
GO
Isoform 9 (identifier: P35240-9) [UniParc]FASTAAdd to basket
Also known as: MER162

The sequence of this isoform differs from the canonical sequence as follows:
     150-579: Missing.

Show »
Length:165
Mass (Da):19,215
Checksum:i01B92CD1AFEEB202
GO
Isoform 10 (identifier: P35240-10) [UniParc]FASTAAdd to basket
Also known as: MER151

The sequence of this isoform differs from the canonical sequence as follows:
     39-121: Missing.
     150-225: Missing.
     334-379: MERQRLAREK...ANEALMRSEE → GQRGRSAEAG...HEPNSSTVAS
     380-595: Missing.

Show »
Length:220
Mass (Da):24,515
Checksum:i05961D105F94276E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti77M → I in AAH20257 (PubMed:15489334).Curated1
Sequence conflicti581T → P in AAK54160 (PubMed:11827459).Curated1
Sequence conflicti581T → P in AAK54162 (PubMed:11827459).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00080946L → R in vestibular schwannoma; loss of ability to interact with the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. 2 Publications1
Natural variantiVAR_00081062F → S in NF2; loss of ability to interact with the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. 4 PublicationsCorresponds to variant dbSNP:rs121434261EnsemblClinVar.1
Natural variantiVAR_04301177M → V in NF2. 1 Publication1
Natural variantiVAR_00081179K → E in vestibular schwannoma. 1 Publication1
Natural variantiVAR_00081296Missing in NF2; also found in sporadic meningioma. 2 Publications1
Natural variantiVAR_000813106E → G in NF2. 2 Publications1
Natural variantiVAR_000814117L → I in sporadic meningioma. 1 Publication1
Natural variantiVAR_000815119Missing in sporadic meningioma; no effect on interaction with SCHIP1. 3 Publications1
Natural variantiVAR_000816122 – 129Missing in sporadic meningioma. 1 Publication8
Natural variantiVAR_065227133C → R in NF2. 1 Publication1
Natural variantiVAR_043012141L → P in NF2; loss of ability to interact with the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. 2 Publications1
Natural variantiVAR_043013197G → C in NF2. 1 Publication1
Natural variantiVAR_000817219V → M in vestibular schwannoma; changed interaction with SCHIP1. 2 Publications1
Natural variantiVAR_000818220N → Y in NF2. 1 Publication1
Natural variantiVAR_009123234L → R in NF2; also found in retinal hamartoma; severe. 1 Publication1
Natural variantiVAR_000819273I → F in breast ductal carcinoma. 1 Publication1
Natural variantiVAR_000820339L → F in sporadic meningioma. 1 Publication1
Natural variantiVAR_029041351R → H1 PublicationCorresponds to variant dbSNP:rs771675702EnsemblClinVar.1
Natural variantiVAR_000821352T → M in NF2. 2 PublicationsCorresponds to variant dbSNP:rs764441073Ensembl.1
Natural variantiVAR_000822360L → P in NF2. Corresponds to variant dbSNP:rs74315492EnsemblClinVar.1
Natural variantiVAR_000823364K → I in melanoma. 1 Publication1
Natural variantiVAR_043014413K → E in NF2. 2 PublicationsCorresponds to variant dbSNP:rs766974263Ensembl.1
Natural variantiVAR_000824418R → C in vestibular schwannoma. 1 PublicationCorresponds to variant dbSNP:rs765540111Ensembl.1
Natural variantiVAR_035848463E → K in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs74315503EnsemblClinVar.1
Natural variantiVAR_043015533K → T in NF2. 1 Publication1
Natural variantiVAR_000825535L → P in NF2; late onset. 3 PublicationsCorresponds to variant dbSNP:rs74315493EnsemblClinVar.1
Natural variantiVAR_000826538Q → P in NF2; mild. 1 PublicationCorresponds to variant dbSNP:rs74315494EnsemblClinVar.1
Natural variantiVAR_043016539L → H in NF2. 1 Publication1
Natural variantiVAR_043017579K → M in NF2. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00704139 – 121Missing in isoform 4 and isoform 10. 3 PublicationsAdd BLAST83
Alternative sequenceiVSP_00704039 – 80Missing in isoform 6. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_00704281 – 121Missing in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_007044150 – 579Missing in isoform 9. 1 PublicationAdd BLAST430
Alternative sequenceiVSP_007043150 – 225Missing in isoform 10. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_007045259N → R in isoform 7. 1 Publication1
Alternative sequenceiVSP_007046260 – 595Missing in isoform 7. 1 PublicationAdd BLAST336
Alternative sequenceiVSP_007047334 – 379MERQR…MRSEE → GQRGRSAEAGPAGSTRGGAK SQAEAPGDCHQAHVPAHEPN SSTVAS in isoform 10. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_007048335 – 363Missing in isoform 8. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_007049380 – 595Missing in isoform 10. 1 PublicationAdd BLAST216
Alternative sequenceiVSP_000492580 – 595LTLQS…FFEEL → SSPRQKTYLHLSPQSRLFPG TLYVVMLYVVMVLPSVILTR A in isoform 2. CuratedAdd BLAST16
Alternative sequenceiVSP_007050580 – 590LTLQSAKSRVA → PQAQGRRPICI in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8. 2 PublicationsAdd BLAST11
Alternative sequenceiVSP_007051591 – 595Missing in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8. 2 Publications5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L11353 mRNA Translation: AAA36212.1
X72655
, X72656, X72657, X72658, X72659, X72660, X72661, X72662, X72663, X72664, X72665, X72666, X72667, X72668, X72669, X72670 Genomic DNA Translation: CAA51220.1
Z22664 mRNA Translation: CAA80377.1
Y18000 Genomic DNA Translation: CAA76992.1
Y18000 Genomic DNA Translation: CAA76993.1
AF122827 mRNA Translation: AAD48752.1
AF122828 mRNA Translation: AAD48753.1
AF123570 mRNA Translation: AAD48754.1
AF369657 mRNA Translation: AAK54160.1
AF369658 mRNA Translation: AAK54161.1
AF369661 mRNA Translation: AAK54162.1
AF369662 mRNA Translation: AAK54163.1
AF369663 mRNA Translation: AAK54164.1
AF369664 mRNA Translation: AAK54165.1
AF369665 mRNA Translation: AAK54166.1
AF369700 mRNA Translation: AAK54195.1
AF369701 mRNA Translation: AAK54196.1
CR456530 mRNA Translation: CAG30416.1
BC003112 mRNA Translation: AAH03112.2
BC020257 mRNA Translation: AAH20257.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13861.1 [P35240-1]
CCDS13862.1 [P35240-3]
CCDS13863.1 [P35240-6]
CCDS13864.1 [P35240-5]
CCDS13865.1 [P35240-4]
CCDS54516.1 [P35240-9]

Protein sequence database of the Protein Information Resource

More...
PIRi
S33809

NCBI Reference Sequences

More...
RefSeqi
NP_000259.1, NM_000268.3 [P35240-1]
NP_057502.2, NM_016418.5 [P35240-3]
NP_861546.1, NM_181825.2 [P35240-3]
NP_861966.1, NM_181828.2 [P35240-6]
NP_861967.1, NM_181829.2 [P35240-5]
NP_861968.1, NM_181830.2 [P35240-4]
NP_861969.1, NM_181831.2 [P35240-4]
NP_861970.1, NM_181832.2 [P35240-3]
NP_861971.1, NM_181833.2 [P35240-9]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000334961; ENSP00000335652; ENSG00000186575 [P35240-4]
ENST00000338641; ENSP00000344666; ENSG00000186575 [P35240-1]
ENST00000353887; ENSP00000340626; ENSG00000186575 [P35240-4]
ENST00000361166; ENSP00000354529; ENSG00000186575 [P35240-3]
ENST00000361452; ENSP00000354897; ENSG00000186575 [P35240-5]
ENST00000361676; ENSP00000355183; ENSG00000186575 [P35240-6]
ENST00000397789; ENSP00000380891; ENSG00000186575 [P35240-3]
ENST00000403435; ENSP00000384029; ENSG00000186575 [P35240-8]
ENST00000403999; ENSP00000384797; ENSG00000186575 [P35240-3]
ENST00000413209; ENSP00000409921; ENSG00000186575 [P35240-9]
ENST00000432151; ENSP00000395885; ENSG00000186575 [P35240-10]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4771

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4771

UCSC genome browser

More...
UCSCi
uc003afy.5 human [P35240-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L11353 mRNA Translation: AAA36212.1
X72655
, X72656, X72657, X72658, X72659, X72660, X72661, X72662, X72663, X72664, X72665, X72666, X72667, X72668, X72669, X72670 Genomic DNA Translation: CAA51220.1
Z22664 mRNA Translation: CAA80377.1
Y18000 Genomic DNA Translation: CAA76992.1
Y18000 Genomic DNA Translation: CAA76993.1
AF122827 mRNA Translation: AAD48752.1
AF122828 mRNA Translation: AAD48753.1
AF123570 mRNA Translation: AAD48754.1
AF369657 mRNA Translation: AAK54160.1
AF369658 mRNA Translation: AAK54161.1
AF369661 mRNA Translation: AAK54162.1
AF369662 mRNA Translation: AAK54163.1
AF369663 mRNA Translation: AAK54164.1
AF369664 mRNA Translation: AAK54165.1
AF369665 mRNA Translation: AAK54166.1
AF369700 mRNA Translation: AAK54195.1
AF369701 mRNA Translation: AAK54196.1
CR456530 mRNA Translation: CAG30416.1
BC003112 mRNA Translation: AAH03112.2
BC020257 mRNA Translation: AAH20257.1
CCDSiCCDS13861.1 [P35240-1]
CCDS13862.1 [P35240-3]
CCDS13863.1 [P35240-6]
CCDS13864.1 [P35240-5]
CCDS13865.1 [P35240-4]
CCDS54516.1 [P35240-9]
PIRiS33809
RefSeqiNP_000259.1, NM_000268.3 [P35240-1]
NP_057502.2, NM_016418.5 [P35240-3]
NP_861546.1, NM_181825.2 [P35240-3]
NP_861966.1, NM_181828.2 [P35240-6]
NP_861967.1, NM_181829.2 [P35240-5]
NP_861968.1, NM_181830.2 [P35240-4]
NP_861969.1, NM_181831.2 [P35240-4]
NP_861970.1, NM_181832.2 [P35240-3]
NP_861971.1, NM_181833.2 [P35240-9]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1H4RX-ray1.80A/B1-313[»]
3U8ZX-ray2.64A/B/C/D18-312[»]
4ZRIX-ray2.70A/B1-320[»]
4ZRJX-ray2.30A1-320[»]
B506-595[»]
6CDSX-ray2.62A/B1-339[»]
SMRiP35240
ModBaseiSearch...

Protein-protein interaction databases

BioGridi110844, 258 interactors
CORUMiP35240
DIPiDIP-35389N
ELMiP35240
IntActiP35240, 46 interactors
MINTiP35240
STRINGi9606.ENSP00000344666

PTM databases

CarbonylDBiP35240
iPTMnetiP35240
PhosphoSitePlusiP35240

Polymorphism and mutation databases

BioMutaiNF2
DMDMi462594

Proteomic databases

EPDiP35240
jPOSTiP35240
MaxQBiP35240
PaxDbiP35240
PeptideAtlasiP35240
PRIDEiP35240
ProteomicsDBi54999
55000 [P35240-10]
55001 [P35240-2]
55002 [P35240-3]
55003 [P35240-4]
55004 [P35240-5]
55005 [P35240-6]
55006 [P35240-7]
55007 [P35240-8]
55008 [P35240-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4771
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334961; ENSP00000335652; ENSG00000186575 [P35240-4]
ENST00000338641; ENSP00000344666; ENSG00000186575 [P35240-1]
ENST00000353887; ENSP00000340626; ENSG00000186575 [P35240-4]
ENST00000361166; ENSP00000354529; ENSG00000186575 [P35240-3]
ENST00000361452; ENSP00000354897; ENSG00000186575 [P35240-5]
ENST00000361676; ENSP00000355183; ENSG00000186575 [P35240-6]
ENST00000397789; ENSP00000380891; ENSG00000186575 [P35240-3]
ENST00000403435; ENSP00000384029; ENSG00000186575 [P35240-8]
ENST00000403999; ENSP00000384797; ENSG00000186575 [P35240-3]
ENST00000413209; ENSP00000409921; ENSG00000186575 [P35240-9]
ENST00000432151; ENSP00000395885; ENSG00000186575 [P35240-10]
GeneIDi4771
KEGGihsa:4771
UCSCiuc003afy.5 human [P35240-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4771
DisGeNETi4771

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NF2
GeneReviewsiNF2
HGNCiHGNC:7773 NF2
HPAiCAB005385
HPA003097
MalaCardsiNF2
MIMi101000 phenotype
156240 phenotype
162091 phenotype
607379 gene
neXtProtiNX_P35240
OpenTargetsiENSG00000186575
Orphaneti637 Neurofibromatosis type 2
93921 Neurofibromatosis type 3
PharmGKBiPA31580

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3529 Eukaryota
ENOG410XQFP LUCA
GeneTreeiENSGT00960000186596
InParanoidiP35240
KOiK16684
OMAiACYAEHR
OrthoDBi627741at2759
PhylomeDBiP35240
TreeFamiTF313935

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-5627123 RHO GTPases activate PAKs
SignaLinkiP35240
SIGNORiP35240

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NF2 human
EvolutionaryTraceiP35240

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Merlin_(protein)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4771
PMAP-CutDBiP35240

Protein Ontology

More...
PROi
PR:P35240

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186575 Expressed in 219 organ(s), highest expression level in smooth muscle tissue
ExpressionAtlasiP35240 baseline and differential
GenevisibleiP35240 HS

Family and domain databases

CDDicd14473 FERM_B-lobe, 1 hit
cd13194 FERM_C_ERM, 1 hit
Gene3Di1.20.80.10, 1 hit
1.25.40.1020, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR019749 Band_41_domain
IPR011174 ERM
IPR011259 ERM_C_dom
IPR041789 ERM_FERM_C
IPR000798 Ez/rad/moesin-like
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR008954 Moesin_tail_sf
IPR011993 PH-like_dom_sf
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00769 ERM, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit
PIRSFiPIRSF002305 ERM, 1 hit
PRINTSiPR00935 BAND41
PR00661 ERMFAMILY
SMARTiView protein in SMART
SM00295 B41, 1 hit
SM01196 FERM_C, 1 hit
SUPFAMiSSF47031 SSF47031, 1 hit
SSF48678 SSF48678, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS00660 FERM_1, 1 hit
PS00661 FERM_2, 1 hit
PS50057 FERM_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMERL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35240
Secondary accession number(s): O95683
, Q8WUJ2, Q969N0, Q969Q3, Q96T30, Q96T31, Q96T32, Q96T33, Q9BTW3, Q9UNG9, Q9UNH3, Q9UNH4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: July 3, 2019
This is version 223 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again