Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (03 Jul 2019)
Sequence version 3 (02 Aug 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein spaetzle

Gene

spz

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The activated form, spaetzle C-106, acts as a ligand for the Toll receptor (PubMed:12872120). Binding to Toll activates the Toll signaling pathway and induces expression of the antifungal peptide drosomycin (PubMed:8808632). Component of the extracellular signaling pathway that establishes dorsal-ventral polarity in the embryo (PubMed:8124709, PubMed:11212919).4 Publications

Miscellaneous

'Spaetzle' means 'noodles' in German.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAntimicrobial, Cytokine, Developmental protein, Fungicide

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-209442 Formation of the trans-membrane 'signalling complex'
R-DME-214842 DL and DIF homodimers bind to TUB and phosphorylated PLL in the TL receptor 'signalling complex'
R-DME-214844 DL and DIF homodimers complexed with CACT are all phosphorylated in the TL receptor 'signalling complex'
R-DME-214862 Activated PLL kinase is autophosphorylated in the TL receptor 'signalling complex'
R-DME-214863 Adaptor protein complex binds to TL receptor at the plasma membrane
R-DME-214869 Phosphorylated CACT, DL and DIF homodimers dissociate from the TL receptor 'signalling complex'
R-DME-214874 PLL kinase binds to TUB in the TL receptor 'signalling complex'

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein spaetzle
Cleaved into the following chain:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:spz
ORF Names:CG6134
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0003495 spz

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi220 – 221RV → LN: Not cleaved when expressed with activated SPE. 1 Publication2
Mutagenesisi234 – 235RK → AA: Abolishes signaling almost completely. 1 Publication2
Mutagenesisi275D → R: Strongly reduced signaling. 1 Publication1
Mutagenesisi318C → S or T: Reduced phenotypic rescue of a mutant. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Add BLAST25
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002240626 – 326Protein spaetzleAdd BLAST301
ChainiPRO_0000022407221 – 326Protein spaetzle C-106Add BLAST106

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi48N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi114N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi164N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi230 ↔ 2881 Publication1 Publication
Disulfide bondi267 ↔ 3191 Publication1 Publication
Disulfide bondi274 ↔ 3211 Publication1 Publication
Disulfide bondi318Interchain1 Publication1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

During embryonic development, easter cleaves the signal peptide and also generates the C-terminal 12 kDa active fragment, C-106 (except for isoform 8.24 and isoform 11.27 as they do not contain the cleavage site) (PubMed:9533958). During the immune response, cleaved in the same manner by SPE (PubMed:16399077).2 Publications
Extracellular forms of isoform 8.19 and isoform 11.7 are glycosylated.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei220 – 221Cleavage; by easter2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P48607

PeptideAtlas

More...
PeptideAtlasi
P48607

PRoteomics IDEntifications database

More...
PRIDEi
P48607

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P48607

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed both maternally and zygotically. All isoforms, except isoform 8.20, are rapidly degraded on cellularisation of the blastoderm embryo.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0003495 Expressed in 32 organ(s), highest expression level in embryonic/larval hemocyte (Drosophila)

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P48607 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P48607 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked (PubMed:12872120, PubMed:9533958). In the presence of Tl, crystal structures show one Tl molecule bound to a spaetzle C-106 homodimer (PubMed:24733933, PubMed:24282309). However, the active complex probably consists of two Tl molecules bound to a spaetzle C-106 homodimer (PubMed:24282309, PubMed:24733933). This is supported by in vitro experiments which also show binding of the spaetzle C-106 dimer to 2 Tl receptors (PubMed:12872120). Ligand binding induces conformational changes in the extracellular domain of Tl (PubMed:24282309). This may enable a secondary homodimerization interface at the C-terminus of the Tl extracellular domain (PubMed:24282309).

1 Publication4 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
68145, 16 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-3140 spaetzle complex

Database of interacting proteins

More...
DIPi
DIP-23237N

Protein interaction database and analysis system

More...
IntActi
P48607, 2 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0084507

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1326
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P48607

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P48607

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini228 – 322SpaetzleSequence analysisAdd BLAST95

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J2BZ Eukaryota
ENOG411266Y LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00700000106225

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P48607

KEGG Orthology (KO)

More...
KOi
K20694

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P48607

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.10.90.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029034 Cystine-knot_cytokine
IPR032104 Spaetzle

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16077 Spaetzle, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57501 SSF57501, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 10 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 8.19 (identifier: P48607-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMTPMWISLF KVLLLLFAFF ATYEAKEYER IIKELFTITN DEGVVLFNTS
60 70 80 90 100
ADSAPFMPIP TQHDDPTQKQ KQNQNQSPIP ETNRHYHQYH SLIQPDQYFK
110 120 130 140 150
VQRSPNGKLN LVFNDTFVSL QRTDTEVQSE QPIPPRHPSD TFVFPDSPIA
160 170 180 190 200
KYRPPQSPAR PLRNDTKEHN PCAKDESQHL RNFCTNVDDY PDLSGLTHKL
210 220 230 240 250
KNNFAKFFSN DLQPTDVSSR VGGSDERFLC RSIRKLVYPK KGLRADDTWQ
260 270 280 290 300
LIVNNDEYKQ AIQIEECEGA DQPCDFAANF PQSYNPICKQ HYTQQTLASI
310 320
KSDGELDVVQ NSFKIPSCCK CALKTG
Length:326
Mass (Da):37,447
Last modified:August 2, 2002 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3252389129CFB1E0
GO
Isoform 8.20 (identifier: P48607-2) [UniParc]FASTAAdd to basket
Also known as: I

The sequence of this isoform differs from the canonical sequence as follows:
     23-121: Missing.

Show »
Length:227
Mass (Da):25,855
Checksum:iE97DD8FA2B60DDF4
GO
Isoform 8.24 (identifier: P48607-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-48: Missing.
     101-121: Missing.
     197-226: THKLKNNFAKFFSNDLQPTDVSSRVGGSDE → RRAIPLQEHQEAGVPKKGLEGGRHLAVNCQ
     227-326: Missing.

Show »
Length:179
Mass (Da):20,566
Checksum:i060CA5A036AFB2B3
GO
Isoform 8.29 (identifier: P48607-5) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     23-67: YEAKEYERII...PIPTQHDDPT → IVYINIELTK...GPGKSASNHL
     68-120: Missing.

Show »
Length:273
Mass (Da):30,872
Checksum:iE74DF94889981C44
GO
Isoform 11.15 (identifier: P48607-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-121: Missing.
     142-151: Missing.

Show »
Length:243
Mass (Da):27,869
Checksum:iFC21AC3256F7C9C5
GO
Isoform 11.27 (identifier: P48607-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-121: Missing.
     189-225: Missing.

Show »
Length:216
Mass (Da):24,918
Checksum:iE9138EE49E766472
GO
Isoform 11.32 (identifier: P48607-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-48: Missing.
     65-189: Missing.

Show »
Length:175
Mass (Da):19,745
Checksum:iAAB6E6FC704D9821
GO
Isoform 11.5 (identifier: P48607-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-185: Missing.

Show »
Length:163
Mass (Da):18,491
Checksum:i6C0D818A9BC10F14
GO
Isoform 11.6 (identifier: P48607-3) [UniParc]FASTAAdd to basket
Also known as: B, 8.23

The sequence of this isoform differs from the canonical sequence as follows:
     23-48: Missing.

Show »
Length:300
Mass (Da):34,331
Checksum:i32BCE90FA9789B2D
GO
Isoform 11.7 (identifier: P48607-9) [UniParc]FASTAAdd to basket
Also known as: C, 23 kDa

The sequence of this isoform differs from the canonical sequence as follows:
     49-121: Missing.

Show »
Length:253
Mass (Da):28,972
Checksum:iCC23F20418C902AF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A1Z0H7A1Z0H7_DROME
Spatzle
spz CT19282, Dmel\CG6134, mel(3)7, SPZ, Spz
270Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8IMP8Q8IMP8_DROME
Spatzle, isoform J
spz CG6134, CT19282, Dmel\CG6134, mel(3)7, SPZ
244Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8IG88Q8IG88_DROME
SD20537p
spz CT19282, Dmel\CG6134, mel(3)7, SPZ, Spz
290Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti50S → T in AAF98130 (PubMed:11212919).Curated1
Sequence conflicti53S → T in AAF98124 (PubMed:11212919).Curated1
Sequence conflicti67T → P in AAL25517 (PubMed:12537569).Curated1
Sequence conflicti75N → D in AAF98130 (PubMed:11212919).Curated1
Sequence conflicti75N → D in AAF98131 (PubMed:11212919).Curated1
Sequence conflicti75N → D in AAF98126 (PubMed:11212919).Curated1
Sequence conflicti147S → F in AAF98132 (PubMed:11212919).Curated1
Sequence conflicti163R → T in AAF98129 (PubMed:11212919).Curated1
Sequence conflicti172C → S in AAF98129 (PubMed:11212919).Curated1
Sequence conflicti197T → R in AAF98125 (PubMed:11212919).Curated1
Sequence conflicti206K → N in AAF98129 (PubMed:11212919).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00442123 – 185Missing in isoform 11.5. CuratedAdd BLAST163
Alternative sequenceiVSP_00442023 – 121Missing in isoform 8.20. CuratedAdd BLAST99
Alternative sequenceiVSP_00441923 – 67YEAKE…HDDPT → IVYINIELTKRHEAEVRAEK TVADYKALLATINNGGPGKS ASNHL in isoform 8.29. CuratedAdd BLAST45
Alternative sequenceiVSP_00441823 – 48Missing in isoform 8.24, isoform 11.32 and isoform 11.6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_00442249 – 121Missing in isoform 11.15, isoform 11.27 and isoform 11.7. CuratedAdd BLAST73
Alternative sequenceiVSP_00442365 – 189Missing in isoform 11.32. CuratedAdd BLAST125
Alternative sequenceiVSP_00442468 – 120Missing in isoform 8.29. CuratedAdd BLAST53
Alternative sequenceiVSP_004425101 – 121Missing in isoform 8.24. CuratedAdd BLAST21
Alternative sequenceiVSP_010257142 – 151Missing in isoform 11.15. Curated10
Alternative sequenceiVSP_004426189 – 225Missing in isoform 11.27. CuratedAdd BLAST37
Alternative sequenceiVSP_004427197 – 226THKLK…GGSDE → RRAIPLQEHQEAGVPKKGLE GGRHLAVNCQ in isoform 8.24. CuratedAdd BLAST30
Alternative sequenceiVSP_004428227 – 326Missing in isoform 8.24. CuratedAdd BLAST100

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U05850 Unassigned DNA Translation: AAA17887.1
AF237964 mRNA Translation: AAF98123.1
AF237965 mRNA Translation: AAF98124.1
AF237966 mRNA Translation: AAF98125.1
AF237967 mRNA Translation: AAF98126.1
AF237968 mRNA Translation: AAF98127.1
AF237969 mRNA Translation: AAF98128.1
AF237970 mRNA Translation: AAF98129.1
AF237971 mRNA Translation: AAF98130.1
AF237972 mRNA Translation: AAF98131.1
AF237973 mRNA Translation: AAF98132.1
AF237974 Genomic DNA Translation: AAF82745.1
AE014297 Genomic DNA Translation: AAF56658.1
AE014297 Genomic DNA Translation: AAN14388.1
AE014297 Genomic DNA Translation: AAN14391.1
AE014297 Genomic DNA Translation: AAN14394.1
AE014297 Genomic DNA Translation: AAN14395.1
AY060478 mRNA Translation: AAL25517.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A53190

NCBI Reference Sequences

More...
RefSeqi
NP_524526.1, NM_079802.3 [P48607-1]
NP_733188.1, NM_170309.2 [P48607-2]
NP_733191.1, NM_170312.2 [P48607-3]
NP_733194.1, NM_170315.2 [P48607-9]
NP_733195.1, NM_170316.2 [P48607-5]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0085137; FBpp0084507; FBgn0003495 [P48607-1]
FBtr0085138; FBpp0084508; FBgn0003495 [P48607-3]
FBtr0085139; FBpp0084509; FBgn0003495 [P48607-9]
FBtr0085140; FBpp0084510; FBgn0003495 [P48607-5]
FBtr0085145; FBpp0084515; FBgn0003495 [P48607-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
43256

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG6134

UCSC genome browser

More...
UCSCi
CG6134-RA d. melanogaster [P48607-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U05850 Unassigned DNA Translation: AAA17887.1
AF237964 mRNA Translation: AAF98123.1
AF237965 mRNA Translation: AAF98124.1
AF237966 mRNA Translation: AAF98125.1
AF237967 mRNA Translation: AAF98126.1
AF237968 mRNA Translation: AAF98127.1
AF237969 mRNA Translation: AAF98128.1
AF237970 mRNA Translation: AAF98129.1
AF237971 mRNA Translation: AAF98130.1
AF237972 mRNA Translation: AAF98131.1
AF237973 mRNA Translation: AAF98132.1
AF237974 Genomic DNA Translation: AAF82745.1
AE014297 Genomic DNA Translation: AAF56658.1
AE014297 Genomic DNA Translation: AAN14388.1
AE014297 Genomic DNA Translation: AAN14391.1
AE014297 Genomic DNA Translation: AAN14394.1
AE014297 Genomic DNA Translation: AAN14395.1
AY060478 mRNA Translation: AAL25517.1
PIRiA53190
RefSeqiNP_524526.1, NM_079802.3 [P48607-1]
NP_733188.1, NM_170309.2 [P48607-2]
NP_733191.1, NM_170312.2 [P48607-3]
NP_733194.1, NM_170315.2 [P48607-9]
NP_733195.1, NM_170316.2 [P48607-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3E07X-ray2.40A/B221-326[»]
4BV4X-ray2.35L/M221-326[»]
4LXRX-ray2.20J/K221-326[»]
4LXSX-ray3.30J/K221-326[»]
SMRiP48607
ModBaseiSearch...

Protein-protein interaction databases

BioGridi68145, 16 interactors
ComplexPortaliCPX-3140 spaetzle complex
DIPiDIP-23237N
IntActiP48607, 2 interactors
STRINGi7227.FBpp0084507

Proteomic databases

PaxDbiP48607
PeptideAtlasiP48607
PRIDEiP48607

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0085137; FBpp0084507; FBgn0003495 [P48607-1]
FBtr0085138; FBpp0084508; FBgn0003495 [P48607-3]
FBtr0085139; FBpp0084509; FBgn0003495 [P48607-9]
FBtr0085140; FBpp0084510; FBgn0003495 [P48607-5]
FBtr0085145; FBpp0084515; FBgn0003495 [P48607-2]
GeneIDi43256
KEGGidme:Dmel_CG6134
UCSCiCG6134-RA d. melanogaster [P48607-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
43256
FlyBaseiFBgn0003495 spz

Phylogenomic databases

eggNOGiENOG410J2BZ Eukaryota
ENOG411266Y LUCA
GeneTreeiENSGT00700000106225
InParanoidiP48607
KOiK20694
PhylomeDBiP48607

Enzyme and pathway databases

ReactomeiR-DME-209442 Formation of the trans-membrane 'signalling complex'
R-DME-214842 DL and DIF homodimers bind to TUB and phosphorylated PLL in the TL receptor 'signalling complex'
R-DME-214844 DL and DIF homodimers complexed with CACT are all phosphorylated in the TL receptor 'signalling complex'
R-DME-214862 Activated PLL kinase is autophosphorylated in the TL receptor 'signalling complex'
R-DME-214863 Adaptor protein complex binds to TL receptor at the plasma membrane
R-DME-214869 Phosphorylated CACT, DL and DIF homodimers dissociate from the TL receptor 'signalling complex'
R-DME-214874 PLL kinase binds to TUB in the TL receptor 'signalling complex'

Miscellaneous databases

EvolutionaryTraceiP48607

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
43256
PMAP-CutDBiP48607

Protein Ontology

More...
PROi
PR:P48607

Gene expression databases

BgeeiFBgn0003495 Expressed in 32 organ(s), highest expression level in embryonic/larval hemocyte (Drosophila)
ExpressionAtlasiP48607 baseline and differential
GenevisibleiP48607 DM

Family and domain databases

Gene3Di2.10.90.10, 1 hit
InterProiView protein in InterPro
IPR029034 Cystine-knot_cytokine
IPR032104 Spaetzle
PfamiView protein in Pfam
PF16077 Spaetzle, 1 hit
SUPFAMiSSF57501 SSF57501, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPZ_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P48607
Secondary accession number(s): Q95SU5, Q9VB84
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: August 2, 2002
Last modified: July 3, 2019
This is version 165 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again