Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 177 (13 Nov 2019)
Sequence version 1 (01 Oct 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sodium/potassium-transporting ATPase subunit beta-3

Gene

ATP1B3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-3 subunit is not known.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport
LigandPotassium, Sodium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-210991 Basigin interactions
R-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Protein family/group databases

Transport Classification Database

More...
TCDBi
3.A.3.1.1 the p-type atpase (p-atpase) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium/potassium-transporting ATPase subunit beta-3
Alternative name(s):
Sodium/potassium-dependent ATPase subunit beta-3
Short name:
ATPB-3
CD_antigen: CD298
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATP1B3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:806 ATP1B3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601867 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P54709

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 35CytoplasmicSequence analysisAdd BLAST35
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei36 – 56Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini57 – 279ExtracellularSequence analysisAdd BLAST223

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
483

Open Targets

More...
OpenTargetsi
ENSG00000069849

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA68

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P54709

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2095186

Drug and drug target database

More...
DrugBanki
DB09479 Rubidium Rb-82

DrugCentral

More...
DrugCentrali
P54709

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATP1B3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1703470

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002191081 – 279Sodium/potassium-transporting ATPase subunit beta-3Add BLAST279

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi124N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi128 ↔ 144By similarity
Disulfide bondi154 ↔ 170By similarity
Disulfide bondi191 ↔ 250By similarity
Glycosylationi240N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-2206

Encyclopedia of Proteome Dynamics

More...
EPDi
P54709

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P54709

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P54709

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P54709

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P54709

PeptideAtlas

More...
PeptideAtlasi
P54709

PRoteomics IDEntifications database

More...
PRIDEi
P54709

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
56697 [P54709-1]
6354

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P54709-1 [P54709-1]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1759

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P54709

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P54709

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P54709

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000069849 Expressed in 115 organ(s), highest expression level in left coronary artery

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P54709 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P54709 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB020697
HPA048963

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The sodium/potassium-transporting ATPase is composed of a catalytic alpha subunit, an auxiliary non-catalytic beta subunit and an additional regulatory subunit.

Curated

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106973, 123 interactors

Database of interacting proteins

More...
DIPi
DIP-50717N

Protein interaction database and analysis system

More...
IntActi
P54709, 50 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000286371

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni186 – 279immunoglobulin-likeBy similarityAdd BLAST94

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal lobe folds into an immunoglobulin-like domain and may mediate cell adhesion properties.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3927 Eukaryota
ENOG411150A LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182754

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000039248

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P54709

KEGG Orthology (KO)

More...
KOi
K01540

Identification of Orthologs from Complete Genome Data

More...
OMAi
GSITINC

Database of Orthologous Groups

More...
OrthoDBi
998086at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P54709

TreeFam database of animal gene trees

More...
TreeFami
TF314618

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.1660, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000402 Na/K_ATPase_sub_beta
IPR038702 Na/K_ATPase_sub_beta_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11523 PTHR11523, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00287 Na_K-ATPase, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01107 Na_K_ATPase_bet, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00390 ATPASE_NA_K_BETA_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P54709-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTKNEKKSLN QSLAEWKLFI YNPTTGEFLG RTAKSWGLIL LFYLVFYGFL
60 70 80 90 100
AALFSFTMWV MLQTLNDEVP KYRDQIPSPG LMVFPKPVTA LEYTFSRSDP
110 120 130 140 150
TSYAGYIEDL KKFLKPYTLE EQKNLTVCPD GALFEQKGPV YVACQFPISL
160 170 180 190 200
LQACSGMNDP DFGYSQGNPC ILVKMNRIIG LKPEGVPRID CVSKNEDIPN
210 220 230 240 250
VAVYPHNGMI DLKYFPYYGK KLHVGYLQPL VAVQVSFAPN NTGKEVTVEC
260 270
KIDGSANLKS QDDRDKFLGR VMFKITARA
Length:279
Mass (Da):31,513
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD92ECB4F0F6EBFE5
GO
Isoform 2 (identifier: P54709-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSW → MLSEGDILFSSLLSSPSLFWPP
     195-279: NEDIPNVAVY...RVMFKITARA → TNNVKDGMKIYQM

Note: No experimental confirmation available.
Show »
Length:193
Mass (Da):21,713
Checksum:i9A6F866ABF2DD7E1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JA36C9JA36_HUMAN
Sodium/potassium-transporting ATPas...
ATP1B3
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JXZ1C9JXZ1_HUMAN
Sodium/potassium-transporting ATPas...
ATP1B3
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J6S2C9J6S2_HUMAN
Sodium/potassium-transporting ATPas...
ATP1B3
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBY4F8WBY4_HUMAN
Sodium/potassium-transporting ATPas...
ATP1B3
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C547H7C547_HUMAN
Sodium/potassium-transporting ATPas...
ATP1B3
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4L9H7C4L9_HUMAN
Sodium/potassium-transporting ATPas...
ATP1B3
27Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0566861 – 36MTKNE…TAKSW → MLSEGDILFSSLLSSPSLFW PP in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_056687195 – 279NEDIP…ITARA → TNNVKDGMKIYQM in isoform 2. 1 PublicationAdd BLAST85

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U51478 mRNA Translation: AAC50665.1
AF005896
, AF005890, AF005891, AF005892, AF005893, AF005894, AF005895 Genomic DNA Translation: AAB61713.1
AK293697 mRNA Translation: BAH11573.1
AC112504 Genomic DNA No translation available.
BC011835 mRNA Translation: AAH11835.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3121.1 [P54709-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
G02485

NCBI Reference Sequences

More...
RefSeqi
NP_001670.1, NM_001679.3 [P54709-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000286371; ENSP00000286371; ENSG00000069849 [P54709-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
483

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:483

UCSC genome browser

More...
UCSCi
uc003eug.2 human [P54709-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U51478 mRNA Translation: AAC50665.1
AF005896
, AF005890, AF005891, AF005892, AF005893, AF005894, AF005895 Genomic DNA Translation: AAB61713.1
AK293697 mRNA Translation: BAH11573.1
AC112504 Genomic DNA No translation available.
BC011835 mRNA Translation: AAH11835.1
CCDSiCCDS3121.1 [P54709-1]
PIRiG02485
RefSeqiNP_001670.1, NM_001679.3 [P54709-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi106973, 123 interactors
DIPiDIP-50717N
IntActiP54709, 50 interactors
STRINGi9606.ENSP00000286371

Chemistry databases

ChEMBLiCHEMBL2095186
DrugBankiDB09479 Rubidium Rb-82
DrugCentraliP54709

Protein family/group databases

TCDBi3.A.3.1.1 the p-type atpase (p-atpase) superfamily

PTM databases

GlyConnecti1759
iPTMnetiP54709
PhosphoSitePlusiP54709
SwissPalmiP54709

Polymorphism and mutation databases

BioMutaiATP1B3
DMDMi1703470

Proteomic databases

CPTACiCPTAC-2206
EPDiP54709
jPOSTiP54709
MassIVEiP54709
MaxQBiP54709
PaxDbiP54709
PeptideAtlasiP54709
PRIDEiP54709
ProteomicsDBi56697 [P54709-1]
6354
TopDownProteomicsiP54709-1 [P54709-1]

Genome annotation databases

EnsembliENST00000286371; ENSP00000286371; ENSG00000069849 [P54709-1]
GeneIDi483
KEGGihsa:483
UCSCiuc003eug.2 human [P54709-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
483
DisGeNETi483

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATP1B3
HGNCiHGNC:806 ATP1B3
HPAiCAB020697
HPA048963
MIMi601867 gene
neXtProtiNX_P54709
OpenTargetsiENSG00000069849
PharmGKBiPA68

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3927 Eukaryota
ENOG411150A LUCA
GeneTreeiENSGT00950000182754
HOGENOMiHOG000039248
InParanoidiP54709
KOiK01540
OMAiGSITINC
OrthoDBi998086at2759
PhylomeDBiP54709
TreeFamiTF314618

Enzyme and pathway databases

ReactomeiR-HSA-210991 Basigin interactions
R-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ATP1B3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ATP1B3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
483
PharosiP54709

Protein Ontology

More...
PROi
PR:P54709

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000069849 Expressed in 115 organ(s), highest expression level in left coronary artery
ExpressionAtlasiP54709 baseline and differential
GenevisibleiP54709 HS

Family and domain databases

Gene3Di2.60.40.1660, 1 hit
InterProiView protein in InterPro
IPR000402 Na/K_ATPase_sub_beta
IPR038702 Na/K_ATPase_sub_beta_sf
PANTHERiPTHR11523 PTHR11523, 1 hit
PfamiView protein in Pfam
PF00287 Na_K-ATPase, 1 hit
TIGRFAMsiTIGR01107 Na_K_ATPase_bet, 1 hit
PROSITEiView protein in PROSITE
PS00390 ATPASE_NA_K_BETA_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAT1B3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P54709
Secondary accession number(s): B7Z1N7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 13, 2019
This is version 177 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again