Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 199 (13 Nov 2019)
Sequence version 3 (16 Dec 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Eukaryotic translation initiation factor 3 subunit B

Gene

EIF3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:9388245, PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:9388245, PubMed:17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773).UniRule annotation4 Publications
(Microbial infection) In case of FCV infection, plays a role in the ribosomal termination-reinitiation event leading to the translation of VP2 (PubMed:18056426).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionInitiation factor, RNA-binding
Biological processProtein biosynthesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-156827 L13a-mediated translational silencing of Ceruloplasmin expression
R-HSA-72649 Translation initiation complex formation
R-HSA-72689 Formation of a pool of free 40S subunits
R-HSA-72695 Formation of the ternary complex, and subsequently, the 43S complex
R-HSA-72702 Ribosomal scanning and start codon recognition
R-HSA-72706 GTP hydrolysis and joining of the 60S ribosomal subunit

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Eukaryotic translation initiation factor 3 subunit BUniRule annotation
Short name:
eIF3bUniRule annotation
Alternative name(s):
Eukaryotic translation initiation factor 3 subunit 9UniRule annotation
Prt1 homolog
Short name:
hPrt1
eIF-3-etaUniRule annotation
eIF3 p110UniRule annotation
eIF3 p116
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EIF3BUniRule annotation
Synonyms:EIF3S9UniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3280 EIF3B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603917 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P55884

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8662

Open Targets

More...
OpenTargetsi
ENSG00000106263

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162384603

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P55884

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EIF3B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
218512094

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001235311 – 814Eukaryotic translation initiation factor 3 subunit BAdd BLAST814

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineUniRule annotationCombined sources1 Publication1
Modified residuei78PhosphoserineCombined sources1
Modified residuei81PhosphoserineCombined sources1
Modified residuei83PhosphoserineUniRule annotationCombined sources1 Publication1
Modified residuei85PhosphoserineUniRule annotationCombined sources1 Publication1
Modified residuei119PhosphoserineUniRule annotation1 Publication1
Modified residuei125PhosphoserineUniRule annotationCombined sources1 Publication1
Modified residuei152PhosphoserineUniRule annotationCombined sources1 Publication1
Modified residuei154PhosphoserineUniRule annotationCombined sources1 Publication1
Modified residuei164PhosphoserineUniRule annotationCombined sources1 Publication1
Modified residuei209N6-acetyllysineCombined sources1
Modified residuei239PhosphoserineCombined sources1
Modified residuei288N6-acetyllysineCombined sources1
Modified residuei364N6-acetyllysineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Phosphorylation is enhanced upon serum stimulation.UniRule annotation1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P55884

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P55884

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P55884

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P55884

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P55884

PeptideAtlas

More...
PeptideAtlasi
P55884

PRoteomics IDEntifications database

More...
PRIDEi
P55884

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
56875 [P55884-1]
56876 [P55884-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P55884

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P55884

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P55884

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000106263 Expressed in 231 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P55884 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P55884 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB017562
HPA048983

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is composed of 13 subunits: EIF3A, EIF3B, EIF3C, EIF3D, EIF3E, EIF3F, EIF3G, EIF3H, EIF3I, EIF3J, EIF3K, EIF3L and EIF3M. The eIF-3 complex appears to include 3 stable modules: module A is composed of EIF3A, EIF3B, EIF3G and EIF3I; module B is composed of EIF3F, EIF3H, and EIF3M; and module C is composed of EIF3C, EIF3D, EIF3E, EIF3K and EIF3L. EIF3C of module C binds EIF3B of module A and EIF3H of module B, thereby linking the three modules. EIF3J is a labile subunit that binds to the eIF-3 complex via EIF3B. The eIF-3 complex interacts with RPS6KB1 under conditions of nutrient depletion. Mitogenic stimulation leads to binding and activation of a complex composed of MTOR and RPTOR, leading to phosphorylation and release of RPS6KB1 and binding of EIF4B to eIF-3.

Also interacts with UPF2 and HNRPD.

Interacts with METTL3 (PubMed:27117702).

UniRule annotation13 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114211, 119 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P55884

Database of interacting proteins

More...
DIPi
DIP-31113N

Protein interaction database and analysis system

More...
IntActi
P55884, 72 interactors

Molecular INTeraction database

More...
MINTi
P55884

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000354125

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1814
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P55884

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P55884

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini185 – 268RRMUniRule annotationAdd BLAST84
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati285 – 324WD 1Add BLAST40
Repeati325 – 365WD 2Add BLAST41
Repeati366 – 425WD 3Add BLAST60
Repeati426 – 489WD 4Add BLAST64
Repeati490 – 553WD 5Add BLAST64
Repeati554 – 598WD 6Add BLAST45
Repeati599 – 642WD 7Add BLAST44
Repeati643 – 685WD 8Add BLAST43

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni124 – 413Sufficient for interaction with EIF3EAdd BLAST290
Regioni170 – 274Sufficient for interaction with EIF3JAdd BLAST105

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RRM domain mediates interaction with EIF3J.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the eIF-3 subunit B family.UniRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2314 Eukaryota
COG5354 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00550000074913

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000265546

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P55884

KEGG Orthology (KO)

More...
KOi
K03253

Identification of Orthologs from Complete Genome Data

More...
OMAi
LIDFSPN

Database of Orthologous Groups

More...
OrthoDBi
1194797at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P55884

TreeFam database of animal gene trees

More...
TreeFami
TF101521

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12278 RRM_eIF3B, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 2 hits
3.30.70.330, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_03001 eIF3b, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011400 EIF3B
IPR034363 eIF3B_RRM
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR013979 TIF_beta_prop-like
IPR015943 WD40/YVTN_repeat-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR14068 PTHR14068, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08662 eIF2A, 1 hit
PF00076 RRM_1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF036424 eIF3b, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360 RRM, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102 RRM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P55884-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQDAENVAVP EAAEERAEPG QQQPAAEPPP AEGLLRPAGP GAPEAAGTEA
60 70 80 90 100
SSEEVGIAEA GPESEVRTEP AAEAEAASGP SESPSPPAAE ELPGSHAEPP
110 120 130 140 150
VPAQGEAPGE QARDERSDSR AQAVSEDAGG NEGRAAEAEP RALENGDADE
160 170 180 190 200
PSFSDPEDFV DDVSEEELLG DVLKDRPQEA DGIDSVIVVD NVPQVGPDRL
210 220 230 240 250
EKLKNVIHKI FSKFGKITND FYPEEDGKTK GYIFLEYASP AHAVDAVKNA
260 270 280 290 300
DGYKLDKQHT FRVNLFTDFD KYMTISDEWD IPEKQPFKDL GNLRYWLEEA
310 320 330 340 350
ECRDQYSVIF ESGDRTSIFW NDVKDPVSIE ERARWTETYV RWSPKGTYLA
360 370 380 390 400
TFHQRGIALW GGEKFKQIQR FSHQGVQLID FSPCERYLVT FSPLMDTQDD
410 420 430 440 450
PQAIIIWDIL TGHKKRGFHC ESSAHWPIFK WSHDGKFFAR MTLDTLSIYE
460 470 480 490 500
TPSMGLLDKK SLKISGIKDF SWSPGGNIIA FWVPEDKDIP ARVTLMQLPT
510 520 530 540 550
RQEIRVRNLF NVVDCKLHWQ KNGDYLCVKV DRTPKGTQGV VTNFEIFRMR
560 570 580 590 600
EKQVPVDVVE MKETIIAFAW EPNGSKFAVL HGEAPRISVS FYHVKNNGKI
610 620 630 640 650
ELIKMFDKQQ ANTIFWSPQG QFVVLAGLRS MNGALAFVDT SDCTVMNIAE
660 670 680 690 700
HYMASDVEWD PTGRYVVTSV SWWSHKVDNA YWLWTFQGRL LQKNNKDRFC
710 720 730 740 750
QLLWRPRPPT LLSQEQIKQI KKDLKKYSKI FEQKDRLSQS KASKELVERR
760 770 780 790 800
RTMMEDFRKY RKMAQELYME QKNERLELRG GVDTDELDSN VDDWEEETIE
810
FFVTEEIIPL GNQE
Length:814
Mass (Da):92,482
Last modified:December 16, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC687A986EDAE0F5E
GO
Isoform 2 (identifier: P55884-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     812-814: NQE → IRSDLEHCAQPCVLWSRGRPAGSRVTPASSLCSLALDCDCAWILPLRHIFVPFSPWCLQWGI

Show »
Length:873
Mass (Da):99,029
Checksum:iD5799E065B3C35D7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JZG1C9JZG1_HUMAN
Eukaryotic translation initiation f...
EIF3B
302Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JQN7C9JQN7_HUMAN
Eukaryotic translation initiation f...
EIF3B
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti115 – 116ER → AG in AAB42010 (PubMed:8995410).Curated2

<p>This subsection of the ‘Sequence’ section reports information derived from mass spectrometry experiments done on the entire protein or on biologically active derived peptide(s).<p><a href='/help/mass_spectrometry' target='_top'>More...</a></p>Mass spectrometryi

Molecular mass is 93093.7 Da from positions 1 - 814. 1 Publication
Molecular mass is 92561±43.5 Da from positions 1 - 814. Determined by MALDI. 1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04797264S → P3 PublicationsCorresponds to variant dbSNP:rs9690787Ensembl.1
Natural variantiVAR_047973793D → E. Corresponds to variant dbSNP:rs1063257Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_017274812 – 814NQE → IRSDLEHCAQPCVLWSRGRP AGSRVTPASSLCSLALDCDC AWILPLRHIFVPFSPWCLQW GI in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U78525 mRNA Translation: AAC99479.1
U62583 mRNA Translation: AAB42010.1
AC004971 Genomic DNA No translation available.
AC004840 Genomic DNA No translation available.
CH236953 Genomic DNA Translation: EAL23951.1
CH471144 Genomic DNA Translation: EAW87237.1
BC001173 mRNA Translation: AAH01173.1
BC110865 mRNA Translation: AAI10866.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5332.1 [P55884-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T09582

NCBI Reference Sequences

More...
RefSeqi
NP_001032360.1, NM_001037283.1 [P55884-1]
NP_003742.2, NM_003751.3 [P55884-1]
XP_011513901.1, XM_011515599.1 [P55884-1]
XP_011513902.1, XM_011515600.1 [P55884-1]
XP_016868241.1, XM_017012752.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000360876; ENSP00000354125; ENSG00000106263 [P55884-1]
ENST00000397011; ENSP00000380206; ENSG00000106263 [P55884-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8662

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8662

UCSC genome browser

More...
UCSCi
uc003slx.4 human [P55884-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U78525 mRNA Translation: AAC99479.1
U62583 mRNA Translation: AAB42010.1
AC004971 Genomic DNA No translation available.
AC004840 Genomic DNA No translation available.
CH236953 Genomic DNA Translation: EAL23951.1
CH471144 Genomic DNA Translation: EAW87237.1
BC001173 mRNA Translation: AAH01173.1
BC110865 mRNA Translation: AAI10866.1
CCDSiCCDS5332.1 [P55884-1]
PIRiT09582
RefSeqiNP_001032360.1, NM_001037283.1 [P55884-1]
NP_003742.2, NM_003751.3 [P55884-1]
XP_011513901.1, XM_011515599.1 [P55884-1]
XP_011513902.1, XM_011515600.1 [P55884-1]
XP_016868241.1, XM_017012752.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KRBNMR-A184-264[»]
2NLWNMR-A170-274[»]
5K1Helectron microscopy4.90B170-745[»]
SMRiP55884
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi114211, 119 interactors
CORUMiP55884
DIPiDIP-31113N
IntActiP55884, 72 interactors
MINTiP55884
STRINGi9606.ENSP00000354125

PTM databases

iPTMnetiP55884
PhosphoSitePlusiP55884
SwissPalmiP55884

Polymorphism and mutation databases

BioMutaiEIF3B
DMDMi218512094

Proteomic databases

EPDiP55884
jPOSTiP55884
MassIVEiP55884
MaxQBiP55884
PaxDbiP55884
PeptideAtlasiP55884
PRIDEiP55884
ProteomicsDBi56875 [P55884-1]
56876 [P55884-2]

Genome annotation databases

EnsembliENST00000360876; ENSP00000354125; ENSG00000106263 [P55884-1]
ENST00000397011; ENSP00000380206; ENSG00000106263 [P55884-1]
GeneIDi8662
KEGGihsa:8662
UCSCiuc003slx.4 human [P55884-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8662
DisGeNETi8662

GeneCards: human genes, protein and diseases

More...
GeneCardsi
EIF3B
HGNCiHGNC:3280 EIF3B
HPAiCAB017562
HPA048983
MIMi603917 gene
neXtProtiNX_P55884
OpenTargetsiENSG00000106263
PharmGKBiPA162384603

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2314 Eukaryota
COG5354 LUCA
GeneTreeiENSGT00550000074913
HOGENOMiHOG000265546
InParanoidiP55884
KOiK03253
OMAiLIDFSPN
OrthoDBi1194797at2759
PhylomeDBiP55884
TreeFamiTF101521

Enzyme and pathway databases

ReactomeiR-HSA-156827 L13a-mediated translational silencing of Ceruloplasmin expression
R-HSA-72649 Translation initiation complex formation
R-HSA-72689 Formation of a pool of free 40S subunits
R-HSA-72695 Formation of the ternary complex, and subsequently, the 43S complex
R-HSA-72702 Ribosomal scanning and start codon recognition
R-HSA-72706 GTP hydrolysis and joining of the 60S ribosomal subunit

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
EIF3B human
EvolutionaryTraceiP55884

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
EIF3B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8662
PharosiP55884

Protein Ontology

More...
PROi
PR:P55884

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000106263 Expressed in 231 organ(s), highest expression level in testis
ExpressionAtlasiP55884 baseline and differential
GenevisibleiP55884 HS

Family and domain databases

CDDicd12278 RRM_eIF3B, 1 hit
Gene3Di2.130.10.10, 2 hits
3.30.70.330, 1 hit
HAMAPiMF_03001 eIF3b, 1 hit
InterProiView protein in InterPro
IPR011400 EIF3B
IPR034363 eIF3B_RRM
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR013979 TIF_beta_prop-like
IPR015943 WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR14068 PTHR14068, 1 hit
PfamiView protein in Pfam
PF08662 eIF2A, 1 hit
PF00076 RRM_1, 1 hit
PIRSFiPIRSF036424 eIF3b, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEIF3B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55884
Secondary accession number(s): A4D208, Q2NL77, Q9UMF9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: December 16, 2008
Last modified: November 13, 2019
This is version 199 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Translation initiation factors
    List of translation initiation factor entries
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again