Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 176 (16 Oct 2019)
Sequence version 1 (11 Jan 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nuclear pore complex protein Nup107

Gene

NUP107

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance (PubMed:12552102, PubMed:15229283, PubMed:30179222). Required for the assembly of peripheral proteins into the NPC (PubMed:15229283, PubMed:12552102). May anchor NUP62 to the NPC (PubMed:15229283). Involved in nephrogenesis (PubMed:30179222).3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232142 SUMOylation of ubiquitinylation proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4085377 SUMOylation of SUMOylation proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5619107 Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6784531 tRNA processing in the nucleus
R-HSA-68877 Mitotic Prometaphase

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear pore complex protein Nup107
Alternative name(s):
107 kDa nucleoporin
Nucleoporin Nup107
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NUP107
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29914 NUP107

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607617 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P57740

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Membrane, Nuclear pore complex, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Nephrotic syndrome 11 (NPHS11)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of nephrotic syndrome, a renal disease clinically characterized by severe proteinuria, resulting in complications such as hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure. NPHS11 is an autosomal recessive, steroid-resistant and progressive form with onset in the first decade of life.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_076358157D → Y in NPHS11; no effect on interaction with NUP133; no effect on localization to the nuclear pore. 1 PublicationCorresponds to variant dbSNP:rs864321633EnsemblClinVar.1
Natural variantiVAR_081357710Missing in NPHS11; unknown pathological significance. 1 Publication1
Natural variantiVAR_076359831D → A in NPHS11; decreased interaction with NUP133; changed localization to the nuclear pore with relocalization to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs864321632EnsemblClinVar.1
Natural variantiVAR_081358889Y → C in NPHS11; decreased function in nephrogenesis; unable to fully rescue morpholino-induced nephrogenesis defects in Xenopus; decreased interaction with NUP133. 1 Publication1
Ovarian dysgenesis 6 (ODG6)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of ovarian dysgenesis, a disorder characterized by lack of spontaneous pubertal development, primary amenorrhea, uterine hypoplasia, and hypergonadotropic hypogonadism as a result of streak gonads. ODG6 is an autosomal recessive condition.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_078571447D → N in ODG6. 1 PublicationCorresponds to variant dbSNP:rs1555178358EnsemblClinVar.1
Galloway-Mowat syndrome 7 (GAMOS7)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of Galloway-Mowat syndrome, a severe renal-neurological disease characterized by early-onset nephrotic syndrome associated with microcephaly, central nervous system abnormalities, developmental delays, and a propensity for seizures. Brain anomalies include gyration defects ranging from lissencephaly to pachygyria and polymicrogyria, and cerebellar hypoplasia. Most patients show facial dysmorphism characterized by a small, narrow forehead, large/floppy ears, deep-set eyes, hypertelorism and micrognathia. Additional variable features are visual impairment and arachnodactyly. Most patients die in early childhood. GAMOS7 inheritance is autosomal recessive.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_081356101M → I in GAMOS7; decreased function in nephrogenesis; unable to fully rescue morpholino-induced nephrogenesis defects in Xenopus; decreased protein amount detected by Western blot in patient cells; affects exon 4 splicing resulting in decreased levels of wild-type mature transcript; impairs assembly of nuclear pore complex. 3 PublicationsCorresponds to variant dbSNP:rs730882216EnsemblClinVar.1
Natural variantiVAR_082054442C → Y in GAMOS7; unknown pathological significance. 1 Publication1

Keywords - Diseasei

Disease mutation, Epilepsy, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
57122

MalaCards human disease database

More...
MalaCardsi
NUP107
MIMi616730 phenotype
618078 phenotype
618348 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000111581

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
243 46,XX gonadal dysgenesis
93213 Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis
2065 Galloway-Mowat syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134890486

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P57740

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NUP107

Domain mapping of disease mutations (DMDM)

More...
DMDMi
12230339

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002048311 – 925Nuclear pore complex protein Nup107Add BLAST925

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei4PhosphoserineCombined sources1
Modified residuei10PhosphoserineCombined sources1
Modified residuei11PhosphoserineCombined sources1
Modified residuei37PhosphoserineCombined sources1
Modified residuei46PhosphothreonineCombined sources1
Modified residuei55PhosphothreonineCombined sources1
Modified residuei57PhosphoserineCombined sources1
Modified residuei58PhosphoserineCombined sources1
Modified residuei60Asymmetric dimethylarginine; alternateBy similarity1
Modified residuei60Omega-N-methylarginine; alternateCombined sources1
Modified residuei64PhosphothreonineCombined sources1
Modified residuei68Omega-N-methylarginineBy similarity1
Modified residuei69PhosphoserineCombined sources1
Modified residuei86PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-986

Encyclopedia of Proteome Dynamics

More...
EPDi
P57740

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P57740

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P57740

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P57740

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P57740

PeptideAtlas

More...
PeptideAtlasi
P57740

PRoteomics IDEntifications database

More...
PRIDEi
P57740

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5575
57028 [P57740-1]
67197

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P57740

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P57740

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P57740

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed in fetal and adult tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111581 Expressed in 219 organ(s), highest expression level in female gonad

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P57740 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P57740 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA031679

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of the nuclear pore complex (NPC) (PubMed:11564755, PubMed:12802065, PubMed:15229283, PubMed:26411495). Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96; this complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus (PubMed:11564755, PubMed:11684705, PubMed:26411495, PubMed:30179222). Does not interact with TPR (PubMed:12802065).

Interacts with ZNF106 (By similarity).

By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
NUP133Q8WUM010EBI-295687,EBI-295695

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121386, 126 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-873 Nuclear pore complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P57740

Protein interaction database and analysis system

More...
IntActi
P57740, 95 interactors

Molecular INTeraction database

More...
MINTi
P57740

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000229179

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1925
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P57740

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P57740

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nucleoporin Nup84/Nup107 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1964 Eukaryota
ENOG410XRUG LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012080

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006750

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P57740

KEGG Orthology (KO)

More...
KOi
K14301

Identification of Orthologs from Complete Genome Data

More...
OMAi
KVQIDIR

Database of Orthologous Groups

More...
OrthoDBi
671846at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P57740

TreeFam database of animal gene trees

More...
TreeFami
TF324259

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007252 Nup84/Nup107

The PANTHER Classification System

More...
PANTHERi
PTHR13003 PTHR13003, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04121 Nup84_Nup100, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P57740-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRSGFGEIS SPVIREAEVT RTARKQSAQK RVLLQASQDE NFGNTTPRNQ
60 70 80 90 100
VIPRTPSSFR QPFTPTSRSL LRQPDISCIL GTGGKSPRLT QSSGFFGNLS
110 120 130 140 150
MVTNLDDSNW AAAFSSQRSG LFTNTEPHSI TEDVTISAVM LREDDPGEAA
160 170 180 190 200
SMSMFSDFLQ SFLKHSSSTV FDLVEEYENI CGSQVNILSK IVSRATPGLQ
210 220 230 240 250
KFSKTASMLW LLQQEMVTWR LLASLYRDRI QSALEEESVF AVTAVNASEK
260 270 280 290 300
TVVEALFQRD SLVRQSQLVV DWLESIAKDE IGEFSDNIEF YAKSVYWENT
310 320 330 340 350
LHTLKQRQLT SYVGSVRPLV TELDPDAPIR QKMPLDDLDR EDEVRLLKYL
360 370 380 390 400
FTLIRAGMTE EAQRLCKRCG QAWRAATLEG WKLYHDPNVN GGTELEPVEG
410 420 430 440 450
NPYRRIWKIS CWRMAEDELF NRYERAIYAA LSGNLKQLLP VCDTWEDTVW
460 470 480 490 500
AYFRVMVDSL VEQEIQTSVA TLDETEELPR EYLGANWTLE KVFEELQATD
510 520 530 540 550
KKRVLEENQE HYHIVQKFLI LGDIDGLMDE FSKWLSKSRN NLPGHLLRFM
560 570 580 590 600
THLILFFRTL GLQTKEEVSI EVLKTYIQLL IREKHTNLIA FYTCHLPQDL
610 620 630 640 650
AVAQYALFLE SVTEFEQRHH CLELAKEADL DVATITKTVV ENIRKKDNGE
660 670 680 690 700
FSHHDLAPAL DTGTTEEDRL KIDVIDWLVF DPAQRAEALK QGNAIMRKFL
710 720 730 740 750
ASKKHEAAKE VFVKIPQDSI AEIYNQCEEQ GMESPLPAED DNAIREHLCI
760 770 780 790 800
RAYLEAHETF NEWFKHMNSV PQKPALIPQP TFTEKVAHEH KEKKYEMDFG
810 820 830 840 850
IWKGHLDALT ADVKEKMYNV LLFVDGGWMV DVREDAKEDH ERTHQMVLLR
860 870 880 890 900
KLCLPMLCFL LHTILHSTGQ YQECLQLADM VSSERHKLYL VFSKEELRKL
910 920
LQKLRESSLM LLDQGLDPLG YEIQL
Length:925
Mass (Da):106,374
Last modified:January 11, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCE1E4DA6C832A5A5
GO
Isoform 2 (identifier: P57740-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MDRSGFGEIS...RTPSSFRQPF → MKILVILHQETRLSLELLAHFDSLVLSTNLLFIV

Note: No experimental confirmation available.
Show »
Length:896
Mass (Da):103,175
Checksum:i5F39C26B982CE197
GO
Isoform 3 (identifier: P57740-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.
     579-666: Missing.

Note: No experimental confirmation available.
Show »
Length:686
Mass (Da):79,971
Checksum:iBC61E0588F57AA4B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YG15H0YG15_HUMAN
Nuclear pore complex protein
NUP107
80Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V1T4G3V1T4_HUMAN
Nuclear pore complex protein Nup107
NUP107 hCG_21433
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GY77F5GY77_HUMAN
Nuclear pore complex protein Nup107
NUP107
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti845Q → R in AAH43343 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_081356101M → I in GAMOS7; decreased function in nephrogenesis; unable to fully rescue morpholino-induced nephrogenesis defects in Xenopus; decreased protein amount detected by Western blot in patient cells; affects exon 4 splicing resulting in decreased levels of wild-type mature transcript; impairs assembly of nuclear pore complex. 3 PublicationsCorresponds to variant dbSNP:rs730882216EnsemblClinVar.1
Natural variantiVAR_076358157D → Y in NPHS11; no effect on interaction with NUP133; no effect on localization to the nuclear pore. 1 PublicationCorresponds to variant dbSNP:rs864321633EnsemblClinVar.1
Natural variantiVAR_082054442C → Y in GAMOS7; unknown pathological significance. 1 Publication1
Natural variantiVAR_078571447D → N in ODG6. 1 PublicationCorresponds to variant dbSNP:rs1555178358EnsemblClinVar.1
Natural variantiVAR_081357710Missing in NPHS11; unknown pathological significance. 1 Publication1
Natural variantiVAR_076359831D → A in NPHS11; decreased interaction with NUP133; changed localization to the nuclear pore with relocalization to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs864321632EnsemblClinVar.1
Natural variantiVAR_081358889Y → C in NPHS11; decreased function in nephrogenesis; unable to fully rescue morpholino-induced nephrogenesis defects in Xenopus; decreased interaction with NUP133. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0542621 – 151Missing in isoform 3. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_0542631 – 63MDRSG…FRQPF → MKILVILHQETRLSLELLAH FDSLVLSTNLLFIV in isoform 2. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_054264579 – 666Missing in isoform 3. 1 PublicationAdd BLAST88

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ295745 mRNA Translation: CAC03716.1
AK302773 mRNA Translation: BAG63979.1
AC090061 Genomic DNA No translation available.
AC124890 Genomic DNA No translation available.
BC017167 mRNA Translation: AAH17167.1
BC043343 mRNA Translation: AAH43343.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS81712.1 [P57740-2]
CCDS8985.1 [P57740-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001317121.1, NM_001330192.1 [P57740-2]
NP_065134.1, NM_020401.3 [P57740-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000229179; ENSP00000229179; ENSG00000111581 [P57740-1]
ENST00000378905; ENSP00000368185; ENSG00000111581 [P57740-3]
ENST00000539906; ENSP00000441448; ENSG00000111581 [P57740-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57122

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57122

UCSC genome browser

More...
UCSCi
uc001suf.4 human [P57740-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ295745 mRNA Translation: CAC03716.1
AK302773 mRNA Translation: BAG63979.1
AC090061 Genomic DNA No translation available.
AC124890 Genomic DNA No translation available.
BC017167 mRNA Translation: AAH17167.1
BC043343 mRNA Translation: AAH43343.1
CCDSiCCDS81712.1 [P57740-2]
CCDS8985.1 [P57740-1]
RefSeqiNP_001317121.1, NM_001330192.1 [P57740-2]
NP_065134.1, NM_020401.3 [P57740-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3CQCX-ray2.53A658-925[»]
3CQGX-ray3.00A658-771[»]
A802-925[»]
3I4RX-ray3.53A658-925[»]
5A9Qelectron microscopy23.004/D/M/V1-925[»]
SMRiP57740
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi121386, 126 interactors
ComplexPortaliCPX-873 Nuclear pore complex
CORUMiP57740
IntActiP57740, 95 interactors
MINTiP57740
STRINGi9606.ENSP00000229179

Protein family/group databases

TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

PTM databases

iPTMnetiP57740
PhosphoSitePlusiP57740
SwissPalmiP57740

Polymorphism and mutation databases

BioMutaiNUP107
DMDMi12230339

Proteomic databases

CPTACiCPTAC-986
EPDiP57740
jPOSTiP57740
MassIVEiP57740
MaxQBiP57740
PaxDbiP57740
PeptideAtlasiP57740
PRIDEiP57740
ProteomicsDBi5575
57028 [P57740-1]
67197

Genome annotation databases

EnsembliENST00000229179; ENSP00000229179; ENSG00000111581 [P57740-1]
ENST00000378905; ENSP00000368185; ENSG00000111581 [P57740-3]
ENST00000539906; ENSP00000441448; ENSG00000111581 [P57740-2]
GeneIDi57122
KEGGihsa:57122
UCSCiuc001suf.4 human [P57740-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57122
DisGeNETi57122

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NUP107
HGNCiHGNC:29914 NUP107
HPAiHPA031679
MalaCardsiNUP107
MIMi607617 gene
616730 phenotype
618078 phenotype
618348 phenotype
neXtProtiNX_P57740
OpenTargetsiENSG00000111581
Orphaneti243 46,XX gonadal dysgenesis
93213 Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis
2065 Galloway-Mowat syndrome
PharmGKBiPA134890486

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1964 Eukaryota
ENOG410XRUG LUCA
GeneTreeiENSGT00390000012080
HOGENOMiHOG000006750
InParanoidiP57740
KOiK14301
OMAiKVQIDIR
OrthoDBi671846at2759
PhylomeDBiP57740
TreeFamiTF324259

Enzyme and pathway databases

ReactomeiR-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232142 SUMOylation of ubiquitinylation proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4085377 SUMOylation of SUMOylation proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5619107 Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6784531 tRNA processing in the nucleus
R-HSA-68877 Mitotic Prometaphase

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NUP107 human
EvolutionaryTraceiP57740

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NUP107

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57122
PharosiP57740

Protein Ontology

More...
PROi
PR:P57740

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111581 Expressed in 219 organ(s), highest expression level in female gonad
ExpressionAtlasiP57740 baseline and differential
GenevisibleiP57740 HS

Family and domain databases

InterProiView protein in InterPro
IPR007252 Nup84/Nup107
PANTHERiPTHR13003 PTHR13003, 1 hit
PfamiView protein in Pfam
PF04121 Nup84_Nup100, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNU107_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P57740
Secondary accession number(s): B4DZ67, Q6PJE1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: January 11, 2001
Last modified: October 16, 2019
This is version 176 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again