Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P97318 (DAB1_MOUSE)

Entry version 163 (18 Sep 2019)
Sequence version 2 (01 Jun 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Disabled homolog 1

Gene

Dab1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter molecule functioning in neural development. May regulate SIAH1 activity.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-8866376 Reelin signalling pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disabled homolog 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dab1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:108554 Dab1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi45K → A: Impairs binding to PtdIns(4,5)P2. 1 Publication1
Mutagenesisi82K → A: Abolishes binding to PtdIns(4,5)P2. 1 Publication1
Mutagenesisi114S → T: Abolishes interaction with APLP1. 1 Publication1
Mutagenesisi136H → R: Greatly impairs interaction with APLP1. 1 Publication1
Mutagenesisi158F → V: Abolishes interaction with APLP1. 1 Publication1
Mutagenesisi185Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-198 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-198; F-200; F-220 and F-232. 1 Publication1
Mutagenesisi198Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-200; F-220 and F-232. 1 Publication1
Mutagenesisi200Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-198. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-220 and F-232. 1 Publication1
Mutagenesisi220Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-232. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-232. Abolishes interaction with CRKL SH2 domain; when associated with F-232. 2 Publications1
Mutagenesisi232Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-220. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-220. Abolishes interaction with CRKL SH2 domain; when associated with F-220. 2 Publications1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000797691 – 588Disabled homolog 1Add BLAST588

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei198Phosphotyrosine2 Publications1
Modified residuei220Phosphotyrosine2 Publications1
Modified residuei232Phosphotyrosine2 Publications1
Modified residuei524Phosphoserine; by CDK51 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons (PubMed:11279201). Also found phosphorylated on Tyr-232 upon reelin induction (PubMed:15062102). Also phosphorylated on Ser-524 independently of reelin signaling.4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...MaxQBi		P97318

PRoteomics IDEntifications database

More...PRIDEi		P97318

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P97318

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P97318

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed mainly in brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000028519 Expressed in 258 organ(s), highest expression level in lumbar subsegment of spinal cord

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P97318 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P97318 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associates with the SH2 domains of SRC, FYN and ABL.

Interacts (phosphorylated on tyrosine residues) with CRK and CRKL (via respective SH2 domain) (PubMed:15062102).

Interacts with SIAH1, LRP8 and VLDLR (PubMed:12646221, PubMed:12737822).

Interacts with LRP1 (By similarity).

Interacts with APLP1 (via NPXY motif) (PubMed:12826668).

Interacts with DAB2IP (By similarity).

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		199042, 13 interactors

Database of interacting proteins

More...DIPi		DIP-30902N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P97318

Protein interaction database and analysis system

More...IntActi		P97318, 18 interactors

Molecular INTeraction database

More...MINTi		P97318

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000102443

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1588
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P97318

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P97318

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini36 – 189PIDPROSITE-ProRule annotationAdd BLAST154

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins.

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158038

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P97318

KEGG Orthology (KO)

More...KOi		K20054

Identification of Orthologs from Complete Genome Data

More...OMAi		DQPSLSC

Database for complete collections of gene phylogenies

More...PhylomeDBi		P97318

TreeFam database of animal gene trees

More...TreeFami		TF316724

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00640 PID, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00462 PTB, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01179 PID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform DAB588 (identifier: P97318-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTETELQVA VKTSAKKDSR KKGQDRSEAT LIKRFKGEGV RYKAKLIGID 
        60         70         80         90        100
EVSAARGDKL CQDSMMKLKG VVAGARSKGE HKQKIFLTIS FGGIKIFDEK 
       110        120        130        140        150
TGALQHHHAV HEISYIAKDI TDHRAFGYVC GKEGNHRFVA IKTAQAAEPV 
       160        170        180        190        200
ILDLRDLFQL IYELKQREEL EKKAQKDKQC EQAVYQTILE EDVEDPVYQY 
       210        220        230        240        250
IVFEAGHEPI RDPETEENIY QVPTSQKKEG VYDVPKSQPN SQPLEDFESR 
       260        270        280        290        300
FAAATPNRNL SMDFDELLEA TKVSAVTQLE LFGDMSTPPD ITSPPTPATP 
       310        320        330        340        350
GDAFLPSSSQ TLPGSADVFG SMSFGTAAVP SGYVAMGAVL PSFWGQQPLV 
       360        370        380        390        400
QQQIAMGAQP PVAQVIPGAQ PIAWGQPGLF PATQQAWPTV AGQFPPAAFM 
       410        420        430        440        450
PTQTVMPLAA AMFQGPLTPL ATVPGTNDSA RSSPQSDKPR QKMGKESFKD 
       460        470        480        490        500
FQMVQPPPVP SRKPDQPSLT CTSEAFSSYF NKVGVAQDTD DCDDFDISQL 
       510        520        530        540        550
NLTPVTSTTP STNSPPTPAP RQSSPSKSSA SHVSDPTADD IFEEGFESPS 
       560        570        580 
KSEEQEAPDG SQASSTSDPF GEPSGEPSGD NISPQDGS
Note: No experimental confirmation available.
Length:588
Mass (Da):63,578
Last modified:June 1, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i08404220792B1DB4
GO
Isoform DAB197 (identifier: P97318-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-23: STETELQVAVKTSAKKDSRKKG → LC
     200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD
     218-588: Missing.

Note: No experimental confirmation available.
Show »
Length:197
Mass (Da):22,236
Checksum:i6AF789B4EC7FF6E9
GO
Isoform DAB204 (identifier: P97318-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-204: YIVFE → NLQKN
     205-588: Missing.

Note: No experimental confirmation available.
Show »
Length:204
Mass (Da):23,077
Checksum:i36271043EFC36BB4
GO
Isoform DAB217 (identifier: P97318-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD
     218-588: Missing.

Show »
Length:217
Mass (Da):24,394
Checksum:i17E7E398F5D1DC01
GO
Isoform DAB271 (identifier: P97318-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-272: Missing.
     275-304: AVTQLELFGDMSTPPDITSPPTPATPGDAF → SLVQSPAAERAEAESRTGPAEPGSILRPLG
     305-588: Missing.

Show »
Length:271
Mass (Da):30,296
Checksum:iFA4A8CE9812EB55C
GO
Isoform DAB553 (identifier: P97318-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-221: Missing.

Note: No experimental confirmation available.
Show »
Length:553
Mass (Da):59,415
Checksum:i8B281EE7C3CFD2F2
GO
Isoform DAB555 (identifier: P97318-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-272: Missing.

Show »
Length:555
Mass (Da):59,838
Checksum:i57A7130311954FE0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MQI4A0A0A0MQI4_MOUSE
Disabled homolog 1
Dab1
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z465F2Z465_MOUSE
Disabled homolog 1
Dab1
258Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6VRL0F6VRL0_MOUSE
Disabled homolog 1
Dab1
214Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29A → R in BAB24163 (PubMed:16141072).Curated1
Sequence conflicti239P → PVS in CAM17685 (PubMed:19468303).Curated1
Sequence conflicti239P → PVS in CAM26758 (PubMed:19468303).Curated1
Sequence conflicti248E → D in CAM17685 (PubMed:19468303).Curated1
Sequence conflicti248E → D in CAM26758 (PubMed:19468303).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0262052 – 23STETE…SRKKG → LC in isoform DAB197. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_026206187 – 221Missing in isoform DAB553. CuratedAdd BLAST35
Alternative sequenceiVSP_003841200 – 217YIVFE…PETEE → VISEPRQGFACSCEGSFD in isoform DAB197 and isoform DAB217. 2 PublicationsAdd BLAST18
Alternative sequenceiVSP_026208200 – 204YIVFE → NLQKN in isoform DAB204. Curated5
Alternative sequenceiVSP_026209205 – 588Missing in isoform DAB204. CuratedAdd BLAST384
Alternative sequenceiVSP_003842218 – 588Missing in isoform DAB197 and isoform DAB217. 2 PublicationsAdd BLAST371
Alternative sequenceiVSP_003843240 – 272Missing in isoform DAB555 and isoform DAB271. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_003844275 – 304AVTQL…PGDAF → SLVQSPAAERAEAESRTGPA EPGSILRPLG in isoform DAB271. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_003845305 – 588Missing in isoform DAB271. 1 PublicationAdd BLAST284

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y08380 mRNA Translation: CAA69663.1
Y08379 mRNA Translation: CAA69662.1
Y08381 mRNA Translation: CAA69664.1
Y08383 Genomic DNA No translation available.
AK005640 mRNA Translation: BAB24163.1
AL627134, AL645483 Genomic DNA Translation: CAM26758.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26759.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26760.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26762.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26765.1
AL645483, AL627134 Genomic DNA Translation: CAM17685.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17686.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17687.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17689.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17690.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19059.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19060.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19062.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19063.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS18413.1 [P97318-2]

NCBI Reference Sequences

More...RefSeqi		NP_034144.1, NM_010014.3 [P97318-6]
NP_796233.2, NM_177259.4 [P97318-2]
XP_011238731.1, XM_011240429.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000106826; ENSMUSP00000102439; ENSMUSG00000028519 [P97318-4]
ENSMUST00000106827; ENSMUSP00000102440; ENSMUSG00000028519 [P97318-5]
ENSMUST00000106830; ENSMUSP00000102443; ENSMUSG00000028519 [P97318-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		13131

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:13131

UCSC genome browser

More...UCSCi		uc008txu.1 mouse [P97318-5]
uc008txv.2 mouse [P97318-6]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08380 mRNA Translation: CAA69663.1
Y08379 mRNA Translation: CAA69662.1
Y08381 mRNA Translation: CAA69664.1
Y08383 Genomic DNA No translation available.
AK005640 mRNA Translation: BAB24163.1
AL627134, AL645483 Genomic DNA Translation: CAM26758.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26759.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26760.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26762.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26765.1
AL645483, AL627134 Genomic DNA Translation: CAM17685.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17686.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17687.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17689.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17690.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19059.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19060.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19062.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19063.1
CCDSiCCDS18413.1 [P97318-2]
RefSeqiNP_034144.1, NM_010014.3 [P97318-6]
NP_796233.2, NM_177259.4 [P97318-2]
XP_011238731.1, XM_011240429.2

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1NTVX-ray1.50A23-174[»]
1NU2X-ray1.90A23-174[»]
1OQNX-ray2.30A/B25-183[»]
SMRiP97318
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi199042, 13 interactors
DIPiDIP-30902N
ELMiP97318
IntActiP97318, 18 interactors
MINTiP97318
STRINGi10090.ENSMUSP00000102443

PTM databases

iPTMnetiP97318
PhosphoSitePlusiP97318

Proteomic databases

MaxQBiP97318
PRIDEiP97318

Genome annotation databases

EnsembliENSMUST00000106826; ENSMUSP00000102439; ENSMUSG00000028519 [P97318-4]
ENSMUST00000106827; ENSMUSP00000102440; ENSMUSG00000028519 [P97318-5]
ENSMUST00000106830; ENSMUSP00000102443; ENSMUSG00000028519 [P97318-2]
GeneIDi13131
KEGGimmu:13131
UCSCiuc008txu.1 mouse [P97318-5]
uc008txv.2 mouse [P97318-6]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1600
MGIiMGI:108554 Dab1

Phylogenomic databases

GeneTreeiENSGT00940000158038
InParanoidiP97318
KOiK20054
OMAiDQPSLSC
PhylomeDBiP97318
TreeFamiTF316724

Enzyme and pathway databases

ReactomeiR-MMU-8866376 Reelin signalling pathway

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Dab1 mouse
EvolutionaryTraceiP97318

Protein Ontology

More...PROi		PR:P97318

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000028519 Expressed in 258 organ(s), highest expression level in lumbar subsegment of spinal cord
ExpressionAtlasiP97318 baseline and differential
GenevisibleiP97318 MM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
PfamiView protein in Pfam
PF00640 PID, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDAB1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P97318
Secondary accession number(s): A2A963
, A2A964, A2A965, A2A966, A2A967, A2A970, P97316, P97317, Q9DAP9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 11, 2002
Last sequence update: June 1, 1998
Last modified: September 18, 2019
This is version 163 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again