Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 186 (05 Jun 2019)
Sequence version 3 (17 Oct 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Interleukin-9 receptor

Gene

IL9R

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is a receptor for interleukin-9.

Miscellaneous

The gene coding for this protein is located in the pseudoautosomal region 2 (PAR2) of X and Y chromosomes.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8985947 Interleukin-9 signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q01113

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q01113

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-9 receptor
Short name:
IL-9 receptor
Short name:
IL-9R
Alternative name(s):
CD_antigen: CD129
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IL9R
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6030 IL9R

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300007 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q01113

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini41 – 270ExtracellularSequence analysisAdd BLAST230
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei271 – 291HelicalSequence analysisAdd BLAST21
Topological domaini292 – 521CytoplasmicSequence analysisAdd BLAST230

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
3581

Open Targets

More...
OpenTargetsi
ENSG00000124334

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29846

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IL9R

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242526

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 40Sequence analysisAdd BLAST40
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001091141 – 521Interleukin-9 receptorAdd BLAST481

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi117N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi156N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q01113

PRoteomics IDEntifications database

More...
PRIDEi
Q01113

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57919
57920 [Q01113-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q01113

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q01113

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000124334 Expressed in 81 organ(s), highest expression level in urinary bladder

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q01113 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA063240
HPA064557

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109795, 23 interactors

Database of interacting proteins

More...
DIPi
DIP-3156N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q01113

Protein interaction database and analysis system

More...
IntActi
Q01113, 2 interactors

Molecular INTeraction database

More...
MINTi
Q01113

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000244174

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini149 – 259Fibronectin type-IIIPROSITE-ProRule annotationAdd BLAST111

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi245 – 249WSXWS motif5
Motifi301 – 309Box 1 motif9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi429 – 438Poly-Ser10
Compositional biasi439 – 442Poly-Asn4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J4GJ Eukaryota
ENOG4111AX0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000049125

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232001

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q01113

KEGG Orthology (KO)

More...
KOi
K05073

Identification of Orthologs from Complete Genome Data

More...
OMAi
GLGRCIW

Database of Orthologous Groups

More...
OrthoDBi
774083at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q01113

TreeFam database of animal gene trees

More...
TreeFami
TF337874

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR003531 Hempt_rcpt_S_F1_CS
IPR013783 Ig-like_fold

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265 SSF49265, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 1 hit
PS01355 HEMATOPO_REC_S_F1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q01113-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLGRCIWEG WTLESEALRR DMGTWLLACI CICTCVCLGV SVTGEGQGPR
60 70 80 90 100
SRTFTCLTNN ILRIDCHWSA PELGQGSSPW LLFTSNQAPG GTHKCILRGS
110 120 130 140 150
ECTVVLPPEA VLVPSDNFTI TFHHCMSGRE QVSLVDPEYL PRRHVKLDPP
160 170 180 190 200
SDLQSNISSG HCILTWSISP ALEPMTTLLS YELAFKKQEE AWEQAQHRDH
210 220 230 240 250
IVGVTWLILE AFELDPGFIH EARLRVQMAT LEDDVVEEER YTGQWSEWSQ
260 270 280 290 300
PVCFQAPQRQ GPLIPPWGWP GNTLVAVSIF LLLTGPTYLL FKLSPRVKRI
310 320 330 340 350
FYQNVPSPAM FFQPLYSVHN GNFQTWMGAH GAGVLLSQDC AGTPQGALEP
360 370 380 390 400
CVQEATALLT CGPARPWKSV ALEEEQEGPG TRLPGNLSSE DVLPAGCTEW
410 420 430 440 450
RVQTLAYLPQ EDWAPTSLTR PAPPDSEGSR SSSSSSSSNN NNYCALGCYG
460 470 480 490 500
GWHLSALPGN TQSSGPIPAL ACGLSCDHQG LETQQGVAWV LAGHCQRPGL
510 520
HEDLQGMLLP SVLSKARSWT F
Length:521
Mass (Da):57,147
Last modified:October 17, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i07C40436466173F3
GO
Isoform 2 (identifier: Q01113-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.

Show »
Length:500
Mass (Da):54,686
Checksum:iC79D0C8C1D330D8F
GO
Isoform 3 (identifier: Q01113-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MGLGRCIWE → MPQTCDGTGQMHLGSNCCKNGQTLLQRTCHGVSCCGWWFQAARSILGKGPSAQSLA
     85-154: SNQAPGGTHK...VKLDPPSDLQ → RLLAAHISAS...WTRSTCPGDT
     297-307: VKRIFYQNVPS → LGWGPTGPVCC
     308-521: Missing.

Show »
Length:342
Mass (Da):37,389
Checksum:iBC2E46EF83989332
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB30844 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti438S → SS in AAA58679 (PubMed:1376929).Curated1
Sequence conflicti438S → SS in AAL55435 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03878463R → K1 PublicationCorresponds to variant dbSNP:rs3093495Ensembl.1
Natural variantiVAR_014804239E → Q1 PublicationCorresponds to variant dbSNP:rs6522Ensembl.1
Natural variantiVAR_033920288Y → C1 PublicationCorresponds to variant dbSNP:rs149119910Ensembl.1
Natural variantiVAR_055348331G → R2 PublicationsCorresponds to variant dbSNP:rs2230001Ensembl.1
Natural variantiVAR_055349365R → H. Corresponds to variant dbSNP:rs2228650Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0390251 – 21Missing in isoform 2. CuratedAdd BLAST21
Alternative sequenceiVSP_0462071 – 9MGLGRCIWE → MPQTCDGTGQMHLGSNCCKN GQTLLQRTCHGVSCCGWWFQ AARSILGKGPSAQSLA in isoform 3. Curated9
Alternative sequenceiVSP_04620885 – 154SNQAP…PSDLQ → RLLAAHISASCGAVSAPSCC HLRQCSCHLTISPSLSTTAC LGGSRSAWWTRSTCPGDT in isoform 3. CuratedAdd BLAST70
Alternative sequenceiVSP_046209297 – 307VKRIFYQNVPS → LGWGPTGPVCC in isoform 3. CuratedAdd BLAST11
Alternative sequenceiVSP_046210308 – 521Missing in isoform 3. CuratedAdd BLAST214

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M84747 mRNA Translation: AAA58679.1
L39064 Genomic DNA Translation: AAC29513.1
AJ271736 Genomic DNA Translation: CAB96817.1
AY071830 Genomic DNA Translation: AAL55435.1
CH471247 Genomic DNA Translation: EAW55884.1
S71404 mRNA Translation: AAB30844.2 Different initiation.
S71420 Genomic DNA Translation: AAD14081.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14771.4 [Q01113-1]
CCDS59180.1 [Q01113-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
B45268

NCBI Reference Sequences

More...
RefSeqi
NP_002177.2, NM_002186.2 [Q01113-1]
NP_789743.2, NM_176786.1 [Q01113-3]
XP_011529456.1, XM_011531154.2 [Q01113-2]
XP_011543951.1, XM_011545649.2 [Q01113-2]
XP_016884986.1, XM_017029497.1 [Q01113-2]
XP_016884987.1, XM_017029498.1 [Q01113-2]
XP_016884988.1, XM_017029499.1 [Q01113-2]
XP_016885535.1, XM_017030046.1 [Q01113-2]
XP_016885536.1, XM_017030047.1 [Q01113-2]
XP_016885537.1, XM_017030048.1 [Q01113-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000244174; ENSP00000244174; ENSG00000124334 [Q01113-1]
ENST00000369423; ENSP00000358431; ENSG00000124334 [Q01113-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3581

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3581

UCSC genome browser

More...
UCSCi
uc004fnu.2 human [Q01113-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M84747 mRNA Translation: AAA58679.1
L39064 Genomic DNA Translation: AAC29513.1
AJ271736 Genomic DNA Translation: CAB96817.1
AY071830 Genomic DNA Translation: AAL55435.1
CH471247 Genomic DNA Translation: EAW55884.1
S71404 mRNA Translation: AAB30844.2 Different initiation.
S71420 Genomic DNA Translation: AAD14081.1
CCDSiCCDS14771.4 [Q01113-1]
CCDS59180.1 [Q01113-3]
PIRiB45268
RefSeqiNP_002177.2, NM_002186.2 [Q01113-1]
NP_789743.2, NM_176786.1 [Q01113-3]
XP_011529456.1, XM_011531154.2 [Q01113-2]
XP_011543951.1, XM_011545649.2 [Q01113-2]
XP_016884986.1, XM_017029497.1 [Q01113-2]
XP_016884987.1, XM_017029498.1 [Q01113-2]
XP_016884988.1, XM_017029499.1 [Q01113-2]
XP_016885535.1, XM_017030046.1 [Q01113-2]
XP_016885536.1, XM_017030047.1 [Q01113-2]
XP_016885537.1, XM_017030048.1 [Q01113-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi109795, 23 interactors
DIPiDIP-3156N
ELMiQ01113
IntActiQ01113, 2 interactors
MINTiQ01113
STRINGi9606.ENSP00000244174

PTM databases

iPTMnetiQ01113
PhosphoSitePlusiQ01113

Polymorphism and mutation databases

BioMutaiIL9R
DMDMi116242526

Proteomic databases

PaxDbiQ01113
PRIDEiQ01113
ProteomicsDBi57919
57920 [Q01113-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3581
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000244174; ENSP00000244174; ENSG00000124334 [Q01113-1]
ENST00000369423; ENSP00000358431; ENSG00000124334 [Q01113-3]
GeneIDi3581
KEGGihsa:3581
UCSCiuc004fnu.2 human [Q01113-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3581
DisGeNETi3581

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IL9R

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0176548
HIX0177609
HGNCiHGNC:6030 IL9R
HPAiHPA063240
HPA064557
MIMi300007 gene
neXtProtiNX_Q01113
OpenTargetsiENSG00000124334
PharmGKBiPA29846

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J4GJ Eukaryota
ENOG4111AX0 LUCA
GeneTreeiENSGT00510000049125
HOGENOMiHOG000232001
InParanoidiQ01113
KOiK05073
OMAiGLGRCIW
OrthoDBi774083at2759
PhylomeDBiQ01113
TreeFamiTF337874

Enzyme and pathway databases

ReactomeiR-HSA-8985947 Interleukin-9 signaling
SignaLinkiQ01113
SIGNORiQ01113

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Interleukin-9_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3581

Protein Ontology

More...
PROi
PR:Q01113

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000124334 Expressed in 81 organ(s), highest expression level in urinary bladder
GenevisibleiQ01113 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR003531 Hempt_rcpt_S_F1_CS
IPR013783 Ig-like_fold
SUPFAMiSSF49265 SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853 FN3, 1 hit
PS01355 HEMATOPO_REC_S_F1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIL9R_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q01113
Secondary accession number(s): B9ZVT0
, Q14634, Q8WWU1, Q96TF0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 17, 2006
Last modified: June 5, 2019
This is version 186 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again