Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 158 (13 Feb 2019)
Sequence version 1 (01 Feb 1995)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Early growth response protein 3

Gene

EGR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable transcription factor involved in muscle spindle development.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri275 – 299C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri305 – 327C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri333 – 355C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q06889

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q06889

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Early growth response protein 3
Short name:
EGR-3
Alternative name(s):
Zinc finger protein pilot
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EGR3
Synonyms:PILOT
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000179388.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3240 EGR3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602419 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q06889

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1960

Open Targets

More...
OpenTargetsi
ENSG00000179388

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27675

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EGR3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
730328

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000471251 – 387Early growth response protein 3Add BLAST387

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q06889

PeptideAtlas

More...
PeptideAtlasi
Q06889

PRoteomics IDEntifications database

More...
PRIDEi
Q06889

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58487

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q06889-1 [Q06889-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q06889

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q06889

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

In T-cells, expressed 20 minutes following activation.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000179388 Expressed in 199 organ(s), highest expression level in parietal pleura

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q06889 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q06889 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB009373
HPA006206

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q06889, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000318057

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q06889

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q06889

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri275 – 299C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri305 – 327C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri333 – 355C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160355

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000036856

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG003909

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q06889

KEGG Orthology (KO)

More...
KOi
K12497

Identification of Orthologs from Complete Genome Data

More...
OMAi
ISHYSQM

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q06889

TreeFam database of animal gene trees

More...
TreeFami
TF318980

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR021849 EGR_N
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11928 DUF3446, 1 hit
PF00096 zf-C2H2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q06889-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTGKLAEKLP VTMSSLLNQL PDNLYPEEIP SALNLFSGSS DSVVHYNQMA
60 70 80 90 100
TENVMDIGLT NEKPNPELSY SGSFQPAPGN KTVTYLGKFA FDSPSNWCQD
110 120 130 140 150
NIISLMSAGI LGVPPASGAL STQTSTASMV QPPQGDVEAM YPALPPYSNC
160 170 180 190 200
GDLYSEPVSF HDPQGNPGLA YSPQDYQSAK PALDSNLFPM IPDYNLYHHP
210 220 230 240 250
NDMGSIPEHK PFQGMDPIRV NPPPITPLET IKAFKDKQIH PGFGSLPQPP
260 270 280 290 300
LTLKPIRPRK YPNRPSKTPL HERPHACPAE GCDRRFSRSD ELTRHLRIHT
310 320 330 340 350
GHKPFQCRIC MRSFSRSDHL TTHIRTHTGE KPFACEFCGR KFARSDERKR
360 370 380
HAKIHLKQKE KKAEKGGAPS ASSAPPVSLA PVVTTCA
Length:387
Mass (Da):42,613
Last modified:February 1, 1995 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i77FAF7D5A278C68E
GO
Isoform 2 (identifier: Q06889-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMAT → MEPCAAWSPRGGR

Note: No experimental confirmation available.
Show »
Length:349
Mass (Da):38,478
Checksum:i32ED293BBFB500B7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RIM5E5RIM5_HUMAN
Early growth response protein 3
EGR3
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti102I → T in BAG58157 (PubMed:14702039).Curated1
Sequence conflicti225I → T in AAB19317 (PubMed:1906159).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0459541 – 51MTGKL…NQMAT → MEPCAAWSPRGGR in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X63741 mRNA Translation: CAA45275.1
S40832 mRNA Translation: AAB19317.1
AK292464 mRNA Translation: BAF85153.1
AK295134 mRNA Translation: BAG58157.1
AK313604 mRNA Translation: BAG36369.1
AC105046 Genomic DNA No translation available.
BC104765 mRNA Translation: AAI04766.1
BC112279 mRNA Translation: AAI12280.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS56528.1 [Q06889-2]
CCDS6033.1 [Q06889-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S60519 S19885

NCBI Reference Sequences

More...
RefSeqi
NP_001186809.1, NM_001199880.1 [Q06889-2]
NP_001186810.1, NM_001199881.1
NP_004421.2, NM_004430.2 [Q06889-1]
XP_005273483.1, XM_005273426.3 [Q06889-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.534313

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000317216; ENSP00000318057; ENSG00000179388 [Q06889-1]
ENST00000522910; ENSP00000430310; ENSG00000179388 [Q06889-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1960

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1960

UCSC genome browser

More...
UCSCi
uc003xcm.2 human [Q06889-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X63741 mRNA Translation: CAA45275.1
S40832 mRNA Translation: AAB19317.1
AK292464 mRNA Translation: BAF85153.1
AK295134 mRNA Translation: BAG58157.1
AK313604 mRNA Translation: BAG36369.1
AC105046 Genomic DNA No translation available.
BC104765 mRNA Translation: AAI04766.1
BC112279 mRNA Translation: AAI12280.1
CCDSiCCDS56528.1 [Q06889-2]
CCDS6033.1 [Q06889-1]
PIRiS60519 S19885
RefSeqiNP_001186809.1, NM_001199880.1 [Q06889-2]
NP_001186810.1, NM_001199881.1
NP_004421.2, NM_004430.2 [Q06889-1]
XP_005273483.1, XM_005273426.3 [Q06889-2]
UniGeneiHs.534313

3D structure databases

ProteinModelPortaliQ06889
SMRiQ06889
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ06889, 2 interactors
STRINGi9606.ENSP00000318057

PTM databases

iPTMnetiQ06889
PhosphoSitePlusiQ06889

Polymorphism and mutation databases

BioMutaiEGR3
DMDMi730328

Proteomic databases

PaxDbiQ06889
PeptideAtlasiQ06889
PRIDEiQ06889
ProteomicsDBi58487
TopDownProteomicsiQ06889-1 [Q06889-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1960
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317216; ENSP00000318057; ENSG00000179388 [Q06889-1]
ENST00000522910; ENSP00000430310; ENSG00000179388 [Q06889-2]
GeneIDi1960
KEGGihsa:1960
UCSCiuc003xcm.2 human [Q06889-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1960
DisGeNETi1960
EuPathDBiHostDB:ENSG00000179388.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
EGR3
HGNCiHGNC:3240 EGR3
HPAiCAB009373
HPA006206
MIMi602419 gene
neXtProtiNX_Q06889
OpenTargetsiENSG00000179388
PharmGKBiPA27675

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000160355
HOGENOMiHOG000036856
HOVERGENiHBG003909
InParanoidiQ06889
KOiK12497
OMAiISHYSQM
OrthoDBi1318335at2759
PhylomeDBiQ06889
TreeFamiTF318980

Enzyme and pathway databases

SignaLinkiQ06889
SIGNORiQ06889

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
EGR3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
EGR3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1960

Protein Ontology

More...
PROi
PR:Q06889

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000179388 Expressed in 199 organ(s), highest expression level in parietal pleura
ExpressionAtlasiQ06889 baseline and differential
GenevisibleiQ06889 HS

Family and domain databases

InterProiView protein in InterPro
IPR021849 EGR_N
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF11928 DUF3446, 1 hit
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEGR3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q06889
Secondary accession number(s): A8K8U9
, B4DHJ5, E7EW38, Q2M3W2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: February 13, 2019
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again