Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 188 (08 May 2019)
Sequence version 2 (13 Apr 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Calcium-activated potassium channel subunit alpha-1

Gene

Kcnma1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by the concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca2+, caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX).1 Publication

Miscellaneous

The protein was initially thought to contain two functionally distinct parts: The core channel (from the N-terminus to the S9 segment) that mediates the channel activity, and the cytoplasmic tail (from the S9 segment to the C-terminus) that mediates the calcium sensing. The situation is however more complex, since the core channel contains binding sites for Ca2+ and Mg2+.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Ethanol and carbon monoxide-bound heme increase channel activation. Heme inhibits channel activation (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi439MagnesiumCurated1
Metal bindingi462MagnesiumCurated1
Metal bindingi464MagnesiumCurated1
Metal bindingi985Calcium; via carbonyl oxygenBy similarity1
Metal bindingi988Calcium; via carbonyl oxygenBy similarity1
Metal bindingi991CalciumBy similarity1
Metal bindingi993CalciumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandCalcium, Magnesium, Metal-binding, Potassium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-1296052 Ca2+ activated K+ channels

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-activated potassium channel subunit alpha-1
Alternative name(s):
BK channel
BKCA alpha
Calcium-activated potassium channel, subfamily M subunit alpha-1
K(VCA)alpha
KCa1.1
Maxi K channel
Short name:
MaxiK
Slo-alpha
Slo1
Short name:
mSlo1
Slowpoke homolog
Short name:
Slo homolog
Short name:
mSlo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kcnma1
Synonyms:Kcnma
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:99923 Kcnma1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 86ExtracellularSequence analysisAdd BLAST86
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei87 – 107Helical; Name=Segment S0Sequence analysisAdd BLAST21
Topological domaini108 – 178CytoplasmicSequence analysisAdd BLAST71
Transmembranei179 – 199Helical; Name=Segment S1Sequence analysisAdd BLAST21
Topological domaini200 – 214ExtracellularSequence analysisAdd BLAST15
Transmembranei215 – 235Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini236 – 239CytoplasmicSequence analysis4
Transmembranei240 – 260Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini261 – 264ExtracellularSequence analysis4
Transmembranei265 – 285Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST21
Topological domaini286 – 300CytoplasmicSequence analysisAdd BLAST15
Transmembranei301 – 321Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini322 – 335ExtracellularSequence analysisAdd BLAST14
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei336 – 358Pore-forming; Name=P regionSequence analysisAdd BLAST23
Topological domaini359 – 367ExtracellularSequence analysis9
Transmembranei368 – 388Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini389 – 1209CytoplasmicSequence analysisAdd BLAST821

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi151V → T: Loss of phosphorylation-independent activation of channel activity by ethanol. CaMK2-dependent phosphorylation leads to populations of partially phosphorylated tetramers with a range of responses to ethanol from activation to inhibition. 1 Publication1
Mutagenesisi272R → Q: Alters the voltage-dependent gating. 1 Publication1
Mutagenesisi278R → Q: Alters the voltage-dependent gating. 1 Publication1
Mutagenesisi284E → R: Alters the voltage-dependent gating; when associated with R-287. 1 Publication1
Mutagenesisi287Q → R: Alters the voltage-dependent gating; when associated with K-284. 1 Publication1
Mutagenesisi427D → A: Does not affect sensitivity to Ca(2+). 1 Publication1
Mutagenesisi432D → A: Reduced sensitivity to Ca(2+). 1 Publication1
Mutagenesisi434D → A: Does not affect sensitivity to Ca(2+). 1 Publication1
Mutagenesisi439E → A: Abolishes sensitivity to Mg(2+), but not sensitivity to Ca(2+). 1 Publication1
Mutagenesisi444H → G: Reduces sensitivity to Mg(2+), but not sensitivity to Ca(2+). 1 Publication1
Mutagenesisi461T → A: Reduces sensitivity to Mg(2+), but not sensitivity to Ca(2+). 1 Publication1
Mutagenesisi462Q → C: Reduces sensitivity to Mg(2+), but not sensitivity to Ca(2+). 1 Publication1
Mutagenesisi464E → D or A: Remains sensitive to Mg(2+). 2 Publications1
Mutagenesisi464E → N: Abolishes sensitivity to Mg(2+), but not sensitivity to Ca(2+). 2 Publications1
Mutagenesisi992 – 996DDDPD → AAAAA: Alters calcium binding. 1 Publication5

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2800

Drug and drug target database

More...
DrugBanki
DB08837 Tetraethylammonium

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
380

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000541341 – 1209Calcium-activated potassium channel subunit alpha-1Add BLAST1209

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi118S-palmitoyl cysteineBy similarity1
Lipidationi119S-palmitoyl cysteineBy similarity1
Lipidationi121S-palmitoyl cysteineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei709PhosphothreonineCombined sources1
Modified residuei711PhosphoserineCombined sources1
Modified residuei724PhosphoserineCombined sources1
Modified residuei728PhosphoserineCombined sources1
Modified residuei916PhosphothreonineCombined sources1
Modified residuei924PhosphoserineCombined sources1
Modified residuei928PhosphoserineCombined sources1
Modified residuei1194PhosphoserineBy similarity1
Modified residuei1197PhosphoserineBy similarity1
Isoform 2 (identifier: Q08460-2)
Modified residuei670PhosphothreonineCombined sources1
Modified residuei672PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated (Probable). Phosphorylation by kinases such as PKA and/or PKG. In smooth muscles, phosphorylation affects its activity.Curated
Palmitoylation by ZDHHC22 and ZDHHC23 within the intracellular linker between the S0 and S1 transmembrane domains regulates localization to the plasma membrane. Depalmitoylated by LYPLA1 and LYPLAL1, leading to retard exit from the trans-Golgi network (By similarity).By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q08460

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q08460

PeptideAtlas

More...
PeptideAtlasi
Q08460

PRoteomics IDEntifications database

More...
PRIDEi
Q08460

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q08460

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q08460

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q08460

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer; which constitutes the calcium-activated potassium channel.

Interacts with beta subunits KCNMB1, KCNMB2, KCNMB3 and KCNMB4.

Interacts with gamma subunits LRRC26, LRRC38, LRRC52 and LRRC55. Beta and gamma subunits are accessory, and modulate its activity (By similarity).

Interacts with RAB11B.

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
200913, 182 interactors

Database of interacting proteins

More...
DIPi
DIP-42413N

Protein interaction database and analysis system

More...
IntActi
Q08460, 197 interactors

Molecular INTeraction database

More...
MINTi
Q08460

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000140275

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q08460

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini415 – 558RCK N-terminalAdd BLAST144

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni556 – 576Segment S7Add BLAST21
Regioni613 – 633Segment S8Add BLAST21
Regioni681 – 685Heme-binding motif5
Regioni783 – 803Segment S9Add BLAST21
Regioni1005 – 1025Segment S10Add BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi352 – 355Selectivity for potassium4
Motifi976 – 998Calcium bowlAdd BLAST23

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi4 – 10Poly-Gly7
Compositional biasi13 – 23Poly-GlyAdd BLAST11
Compositional biasi40 – 60Poly-SerAdd BLAST21

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The S0 segment is essential for the modulation by the accessory beta subunits KCNMB1, KCNMB2, KCNMB3 and KCNMB4.
The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor.
The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium.
The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel. It includes binding sites for Ca2+ and Mg2+.
The calcium bowl constitutes one of the Ca2+ sensors and probably acts as a Ca2+-binding site. There are however other Ca2+ sensors regions required for activation of the channel.
The heme-binding motif mediates inhibition of channel activation by heme. Carbon monoxide-bound heme leads to increased channel activation (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1420 Eukaryota
ENOG410YUX1 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000019856

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q08460

KEGG Orthology (KO)

More...
KOi
K04936

Database of Orthologous Groups

More...
OrthoDBi
124461at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q08460

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024939 Ca-act_K_channel_Slo-1
IPR005821 Ion_trans_dom
IPR003929 K_chnl_BK_asu
IPR036291 NAD(P)-bd_dom_sf
IPR027359 Volt_channel_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10027:SF28 PTHR10027:SF28, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03493 BK_channel_a, 1 hit
PF00520 Ion_trans, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51735 SSF51735, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: May be partially controlled by hormonal stress. Additional isoforms seem to exist.

This entry has 5 described isoforms and 33 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q08460-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANGGGGGGG SSGGGGGGGG GSGLRMSSNI HANNLSLDAS SSSSSSSSSS
60 70 80 90 100
SSSSSSSSSS VHEPKMDALI IPVTMEVPCD SRGQRMWWAF LASSMVTFFG
110 120 130 140 150
GLFIILLWRT LKYLWTVCCH CGGKTKEAQK INNGSSQADG TLKPVDEKEE
160 170 180 190 200
VVAAEVGWMT SVKDWAGVMI SAQTLTGRVL VVLVFALSIG ALVIYFIDSS
210 220 230 240 250
NPIESCQNFY KDFTLQIDMA FNVFFLLYFG LRFIAANDKL WFWLEVNSVV
260 270 280 290 300
DFFTVPPVFV SVYLNRSWLG LRFLRALRLI QFSEILQFLN ILKTSNSIKL
310 320 330 340 350
VNLLSIFIST WLTAAGFIHL VENSGDPWEN FQNNQALTYW ECVYLLMVTM
360 370 380 390 400
STVGYGDVYA KTTLGRLFMV FFILGGLAMF ASYVPEIIEL IGNRKKYGGS
410 420 430 440 450
YSAVSGRKHI VVCGHITLES VSNFLKDFLH KDRDDVNVEI VFLHNISPNL
460 470 480 490 500
ELEALFKRHF TQVEFYQGSV LNPHDLARVK IESADACLIL ANKYCADPDA
510 520 530 540 550
EDASNIMRVI SIKNYHPKIR IITQMLQYHN KAHLLNIPSW NWKEGDDAIC
560 570 580 590 600
LAELKLGFIA QSCLAQGLST MLANLFSMRS FIKIEEDTWQ KYYLEGVSNE
610 620 630 640 650
MYTEYLSSAF VGLSFPTVCE LCFVKLKLLM IAIEYKSANR ESRSRKRILI
660 670 680 690 700
NPGNHLKIQE GTLGFFIASD AKEVKRAFFY CKACHDDVTD PKRIKKCGCR
710 720 730 740 750
RLEDEQPPTL SPKKKQRNGG MRNSPNTSPK LMRHDPLLIP GNDQIDNMDS
760 770 780 790 800
NVKKYDSTGM FHWCAPKEIE KVILTRSEAA MTVLSGHVVV CIFGDVSSAL
810 820 830 840 850
IGLRNLVMPL RASNFHYHEL KHIVFVGSIE YLKREWETLH NFPKVSILPG
860 870 880 890 900
TPLSRADLRA VNINLCDMCV ILSANQNNID DTSLQDKECI LASLNIKSMQ
910 920 930 940 950
FDDSIGVLQA NSQGFTPPGM DRSSPDNSPV HGMLRQPSIT TGVNIPIITE
960 970 980 990 1000
LAKPGKLPLV SVNQEKNSGT HILMITELVN DTNVQFLDQD DDDDPDTELY
1010 1020 1030 1040 1050
LTQPFACGTA FAVSVLDSLM SATYFNDNIL TLIRTLVTGG ATPELEALIA
1060 1070 1080 1090 1100
EENALRGGYS TPQTLANRDR CRVAQLALLD GPFADLGDGG CYGDLFCKAL
1110 1120 1130 1140 1150
KTYNMLCFGI YRLRDAHLST PSQCTKRYVI TNPPYEFELV PTDLIFCLMQ
1160 1170 1180 1190 1200
FDHNAGQSRA SLSHSSHSSQ SSSKKSSSVH SIPSTANRPN RPKSRESRDK

QNRKEMVYR
Length:1,209
Mass (Da):134,396
Last modified:April 13, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9E07ABF5DCFA62DF
GO
Isoform 2 (identifier: Q08460-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MANGGGGGGGSSGGGGGGGGGSGLRMSSNIHANNLSLDASSSSSSSSSSS → MELEHPKSPPYP
     643-646: Missing.
     702-702: L → LIYF
     948-974: Missing.
     1203-1209: RKEMVYR → ATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC

Show »
Length:1,196
Mass (Da):134,573
Checksum:i1E13E02FF1398741
GO
Isoform 3 (identifier: Q08460-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     643-646: Missing.
     948-974: Missing.

Show »
Length:1,178
Mass (Da):130,968
Checksum:i99B595E2DCAC798D
GO
Isoform 4 (identifier: Q08460-4) [UniParc]FASTAAdd to basket
Also known as: STREX-1

The sequence of this isoform differs from the canonical sequence as follows:
     643-646: Missing.
     702-702: L → PKMSIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDTLERTFPLSSVSVNDCSTSFRAF
     948-974: Missing.

Show »
Length:1,236
Mass (Da):137,559
Checksum:i2063B0C61095EAB0
GO
Isoform 5 (identifier: Q08460-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.

Show »
Length:1,144
Mass (Da):128,691
Checksum:i6F6028D132C562E4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 33 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WQN5A0A087WQN5_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,239Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WQ41A0A087WQ41_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WRS4A0A087WRS4_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,236Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YD35A0A286YD35_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,209Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YDM6A0A286YDM6_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,242Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QMT8J3QMT8_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q9P4E9Q9P4_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,053Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7BHL0F7BHL0_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,055Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6ZSN2F6ZSN2_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QN27J3QN27_MOUSE
Calcium-activated potassium channel...
Kcnma1
1,132Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA50215 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0099591 – 65Missing in isoform 5. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_0099601 – 50MANGG…SSSSS → MELEHPKSPPYP in isoform 2. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_009961643 – 646Missing in isoform 2, isoform 3 and isoform 4. 3 Publications4
Alternative sequenceiVSP_009962702L → LIYF in isoform 2. 1 Publication1
Alternative sequenceiVSP_009963702L → PKMSIYKRMRRACCFDCGRS ERDCSCMSGRVRGNVDTLER TFPLSSVSVNDCSTSFRAF in isoform 4. 1 Publication1
Alternative sequenceiVSP_009964948 – 974Missing in isoform 2, isoform 3 and isoform 4. 3 PublicationsAdd BLAST27
Alternative sequenceiVSP_0099651203 – 1209RKEMVYR → ATRMTRMGQAEKKWFTDEPD NAYPRNIQIKPMSTHMANQI NQYKSTSSLIPPIREVEDEC in isoform 2. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U09383 mRNA Translation: AAA50215.1 Different initiation.
L16912 mRNA Translation: AAA39746.1
AF156674 mRNA Translation: AAD49225.1
AF465244 mRNA Translation: AAL69971.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS79275.1 [Q08460-3]
CCDS79276.1 [Q08460-4]
CCDS79277.1 [Q08460-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A48206
I49017

NCBI Reference Sequences

More...
RefSeqi
NP_001240294.1, NM_001253365.1
NP_001240298.1, NM_001253369.1
NP_034740.2, NM_010610.3

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
16531

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:16531

UCSC genome browser

More...
UCSCi
uc029sfy.1 mouse [Q08460-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U09383 mRNA Translation: AAA50215.1 Different initiation.
L16912 mRNA Translation: AAA39746.1
AF156674 mRNA Translation: AAD49225.1
AF465244 mRNA Translation: AAL69971.1
CCDSiCCDS79275.1 [Q08460-3]
CCDS79276.1 [Q08460-4]
CCDS79277.1 [Q08460-1]
PIRiA48206
I49017
RefSeqiNP_001240294.1, NM_001253365.1
NP_001240298.1, NM_001253369.1
NP_034740.2, NM_010610.3

3D structure databases

SMRiQ08460
ModBaseiSearch...

Protein-protein interaction databases

BioGridi200913, 182 interactors
DIPiDIP-42413N
IntActiQ08460, 197 interactors
MINTiQ08460
STRINGi10090.ENSMUSP00000140275

Chemistry databases

ChEMBLiCHEMBL2800
DrugBankiDB08837 Tetraethylammonium
GuidetoPHARMACOLOGYi380

PTM databases

iPTMnetiQ08460
PhosphoSitePlusiQ08460
SwissPalmiQ08460

Proteomic databases

MaxQBiQ08460
PaxDbiQ08460
PeptideAtlasiQ08460
PRIDEiQ08460

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi16531
KEGGimmu:16531
UCSCiuc029sfy.1 mouse [Q08460-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3778
MGIiMGI:99923 Kcnma1

Phylogenomic databases

eggNOGiKOG1420 Eukaryota
ENOG410YUX1 LUCA
HOGENOMiHOG000019856
InParanoidiQ08460
KOiK04936
OrthoDBi124461at2759
PhylomeDBiQ08460

Enzyme and pathway databases

ReactomeiR-MMU-1296052 Ca2+ activated K+ channels

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Kcnma1 mouse

Protein Ontology

More...
PROi
PR:Q08460

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

Gene3Di1.20.120.350, 1 hit
InterProiView protein in InterPro
IPR024939 Ca-act_K_channel_Slo-1
IPR005821 Ion_trans_dom
IPR003929 K_chnl_BK_asu
IPR036291 NAD(P)-bd_dom_sf
IPR027359 Volt_channel_dom_sf
PANTHERiPTHR10027:SF28 PTHR10027:SF28, 1 hit
PfamiView protein in Pfam
PF03493 BK_channel_a, 1 hit
PF00520 Ion_trans, 1 hit
SUPFAMiSSF51735 SSF51735, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCMA1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q08460
Secondary accession number(s): Q64703, Q8VHF1, Q9R196
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: April 13, 2004
Last modified: May 8, 2019
This is version 188 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again