Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (16 Jan 2019)
Sequence version 1 (01 Oct 1996)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase

Gene

ST3GAL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS04994-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.4.99.6 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1912420 Pre-NOTCH Processing in Golgi
R-HSA-2022854 Keratan sulfate biosynthesis
R-HSA-3656243 Defective ST3GAL3 causes MCT12 and EIEE15
R-HSA-4085001 Sialic acid metabolism
R-HSA-977068 Termination of O-glycan biosynthesis

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q11203

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00378

Protein family/group databases

Carbohydrate-Active enZymes

More...
CAZyi
GT29 Glycosyltransferase Family 29

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (EC:2.4.99.6By similarity)
Alternative name(s):
Beta-galactoside alpha-2,3-sialyltransferase 3
Short name:
Alpha 2,3-ST 3
Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase
N-acetyllactosaminide alpha-2,3-sialyltransferase
ST3Gal III
Short name:
ST3GalIII
ST3N
Sialyltransferase 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ST3GAL3
Synonyms:SIAT6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000126091.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10866 ST3GAL3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606494 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q11203

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 8CytoplasmicSequence analysis8
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei9 – 28Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST20
Topological domaini29 – 375LumenalSequence analysisAdd BLAST347

Keywords - Cellular componenti

Golgi apparatus, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Mental retardation, autosomal recessive 12 (MRT12)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period.
See also OMIM:611090
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06659413A → D in MRT12; most of the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function. 1 PublicationCorresponds to variant dbSNP:rs387906943EnsemblClinVar.1
Natural variantiVAR_066595370D → Y in MRT12; the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function; shows a complete lack of enzyme activity; secretion of the mutant protein is dramatically reduced compared to wild-type. 1 Publication1
Epileptic encephalopathy, early infantile, 15 (EIEE15)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epilepsy that manifests in the neonatal or the early infantile period as severely impaired cognitive and motor development, due to recurrent clinical seizures or prominent interictal epileptiform discharges. Patients develop infantile spasms, mainly of the flexor type, between 3 and 7 months of age, which are accompanied by hypsarrhythmia on EEG. Other features include poor eye contact, hypotonia, primitive reflexes, and irritability. Seizures evolve clinically to Lennox-Gastaut syndrome.
See also OMIM:615006
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069319320A → P in EIEE15. 1 Publication1

Keywords - Diseasei

Disease mutation, Epilepsy, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
6487

MalaCards human disease database

More...
MalaCardsi
ST3GAL3
MIMi611090 phenotype
615006 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000126091

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
88616 Autosomal recessive non-syndromic intellectual disability
3451 West syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35768

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3596076

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ST3GAL3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1705561

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001492661 – 375CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferaseAdd BLAST375

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi80N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi160 ↔ 314By similarity
Glycosylationi171N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The soluble form derives from the membrane form by proteolytic processing.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PeptideAtlas

More...
PeptideAtlasi
Q11203

PRoteomics IDEntifications database

More...
PRIDEi
Q11203

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58874
58875 [Q11203-10]
58876 [Q11203-11]
58877 [Q11203-12]
58878 [Q11203-13]
58879 [Q11203-14]
58880 [Q11203-15]
58881 [Q11203-16]
58882 [Q11203-17]
58883 [Q11203-18]
58884 [Q11203-19]
58885 [Q11203-2]
58886 [Q11203-20]
58887 [Q11203-21]
58888 [Q11203-22]
58889 [Q11203-23]
58890 [Q11203-24]
58891 [Q11203-25]
58892 [Q11203-26]
58893 [Q11203-3]
58894 [Q11203-4]
58895 [Q11203-5]
58896 [Q11203-6]
58897 [Q11203-7]
58898 [Q11203-8]
58899 [Q11203-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q11203

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q11203

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in adult skeletal muscle and in all fetal tissues examined and to a much lesser extent in placenta, lung and liver.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000126091 Expressed in 171 organ(s), highest expression level in pituitary gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q11203 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q11203 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA051102

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112379, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q11203, 5 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q11203

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glycosyltransferase 29 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157285

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG056676

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q11203

KEGG Orthology (KO)

More...
KOi
K00781

Identification of Orthologs from Complete Genome Data

More...
OMAi
EGVCKPG

Database of Orthologous Groups

More...
OrthoDBi
1358010at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q11203

TreeFam database of animal gene trees

More...
TreeFami
TF354325

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.1480.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001675 Glyco_trans_29
IPR038578 GT29-like_sf
IPR012163 Sialyl_trans

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00777 Glyco_transf_29, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005557 Sialyl_trans, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (26+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 26 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 26 described isoforms and 37 potential isoforms that are computationally mapped.Show allAlign All

Isoform B1 (identifier: Q11203-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLLVFVRNL LLALCLFLVL GFLYYSAWKL HLLQWEEDSN SVVLSFDSAG
60 70 80 90 100
QTLGSEYDRL GFLLNLDSKL PAELATKYAN FSEGACKPGY ASALMTAIFP
110 120 130 140 150
RFSKPAPMFL DDSFRKWARI REFVPPFGIK GQDNLIKAIL SVTKEYRLTP
160 170 180 190 200
ALDSLRCRRC IIVGNGGVLA NKSLGSRIDD YDIVVRLNSA PVKGFEKDVG
210 220 230 240 250
SKTTLRITYP EGAMQRPEQY ERDSLFVLAG FKWQDFKWLK YIVYKERVSA
260 270 280 290 300
SDGFWKSVAT RVPKEPPEIR ILNPYFIQEA AFTLIGLPFN NGLMGRGNIP
310 320 330 340 350
TLGSVAVTMA LHGCDEVAVA GFGYDMSTPN APLHYYETVR MAAIKESWTH
360 370
NIQREKEFLR KLVKARVITD LSSGI
Length:375
Mass (Da):42,171
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC9B7B61AD580EC2E
GO
Isoform A1 (identifier: Q11203-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-40: N → SKYSHSSSPQEKPVAD

Show »
Length:390
Mass (Da):43,786
Checksum:iDCBE59B0BFF74B3A
GO
Isoform A7 (identifier: Q11203-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-40: N → SKYSHSSSPQEKPVAD
     133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
     156-375: Missing.

Show »
Length:170
Mass (Da):19,043
Checksum:i73BE2801C40F2F9B
GO
Isoform A8 (identifier: Q11203-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-40: N → SKYSHSSSPQEKPVAD
     70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

Show »
Length:444
Mass (Da):49,649
Checksum:iEDFBE742E527970E
GO
Isoform B1-90 (identifier: Q11203-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     249-278: Missing.

Show »
Length:345
Mass (Da):38,742
Checksum:i0AA0ED4823826782
GO
Isoform B1+32 (identifier: Q11203-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-189: LNS → PRL
     190-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:189
Mass (Da):21,204
Checksum:i73A783656B89AAF0
GO
Isoform B3 (identifier: Q11203-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-101: Missing.

Show »
Length:344
Mass (Da):38,912
Checksum:i9BA97BCA7FA29E8A
GO
Isoform B4 (identifier: Q11203-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     249-346: Missing.

Show »
Length:277
Mass (Da):31,587
Checksum:i7C84EE03A5D6ABCE
GO
Isoform B4+173 (identifier: Q11203-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-115: FSKPAPMFLDDSFR → EKVRTFMAWLAWYG
     116-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:115
Mass (Da):12,969
Checksum:i933010B3A0B41729
GO
Isoform B5+26 (identifier: Q11203-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-375: Missing.

Show »
Length:186
Mass (Da):20,837
Checksum:iE56B89AAF01B90F8
GO
Isoform B5+173 (identifier: Q11203-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-121: FSKPAPMFLDDSFRKWARIR → AKRNGAWRQKHIQAYVLRQR
     122-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:121
Mass (Da):13,691
Checksum:i709ABCEF09B26251
GO
Isoform B7 (identifier: Q11203-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
     156-375: Missing.

Show »
Length:155
Mass (Da):17,428
Checksum:iA881E409E96468F9
GO
Isoform B8 (identifier: Q11203-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

Show »
Length:429
Mass (Da):48,034
Checksum:iDF45CA4E6D931B3D
GO
Isoform B10 (identifier: Q11203-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-151: DNLIKAILSVTKEYRLTPA → ECIGWLLEICGHSSAQGAP
     152-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:151
Mass (Da):16,834
Checksum:i8EF2DF5A045B8511
GO
Isoform C1 (identifier: Q11203-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K

Show »
Length:359
Mass (Da):40,606
Checksum:i8A84C7FB0ABDD7C9
GO
Isoform C4 (identifier: Q11203-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     249-346: Missing.

Show »
Length:261
Mass (Da):30,022
Checksum:i3DC939A6817E18B0
GO
Isoform C5 (identifier: Q11203-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     186-202: RLNSAPVKGFEKDVGSK → SPGRTISSERKSFCGSW
     203-375: Missing.

Show »
Length:186
Mass (Da):20,984
Checksum:i1E7D22F363B85B30
GO
Isoform C7 (identifier: Q11203-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
     156-375: Missing.

Show »
Length:139
Mass (Da):15,863
Checksum:i04B51A49F74C6F42
GO
Isoform C8 (identifier: Q11203-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

Show »
Length:413
Mass (Da):46,469
Checksum:i1CD13FC0AEB4560D
GO
Isoform C9 (identifier: Q11203-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     187-244: LNSAPVKGFE...DFKWLKYIVY → VHRMASGNLW...GTSLPLAVWQ
     245-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:228
Mass (Da):25,558
Checksum:i87D5C4311A1FE514
GO
Isoform C11 (identifier: Q11203-21) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     71-101: Missing.
     249-346: Missing.

Show »
Length:230
Mass (Da):26,763
Checksum:i073EA4B17DC68FB0
GO
Isoform C12 (identifier: Q11203-22) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     102-117: FSKPAPMFLDDSFRKW → PGRTISSERKSFCGSW
     118-375: Missing.

Show »
Length:101
Mass (Da):11,444
Checksum:i33196D8AF2BED686
GO
Isoform D2+26 (identifier: Q11203-23) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-55: NSVVLSFDSAGQTLGS → SKYSHSSSPQEKPVA
     187-375: Missing.

Show »
Length:185
Mass (Da):20,887
Checksum:iC50EA375D4F01821
GO
Isoform D5 (identifier: Q11203-24) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-55: NSVVLSFDSAGQTLGS → SKYSHSSSPQEKPVA
     186-202: RLNSAPVKGFEKDVGSK → SPGRTISSERKSFCGSW
     203-375: Missing.

Show »
Length:201
Mass (Da):22,598
Checksum:i14056E7DD7DD50AB
GO
Isoform E1 (identifier: Q11203-25) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-43: NSVV → SLLN
     44-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:43
Mass (Da):5,056
Checksum:i9E7CF581E6CD3813
GO
Isoform E3+32 (identifier: Q11203-26) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-73: NSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAE → SSPSQHPCSWMTPFASGLESGSSCRLLGSKVKTI
     74-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:73
Mass (Da):8,178
Checksum:iDE5BE566E4BDF07D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 37 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y732A0A2R8Y732_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
418Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6H4A0A2R8Y6H4_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
434Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YDJ6A0A2R8YDJ6_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
449Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y7D8A0A2R8Y7D8_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
411Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2U3TZK9A0A2U3TZK9_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
406Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6L4A0A2R8Y6L4_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
331Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y7J2A0A2R8Y7J2_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
344Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2U3TZM2A0A2U3TZM2_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
380Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2U3TZH9A0A2U3TZH9_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
304Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YFM5A0A2R8YFM5_HUMAN
CMP-N-acetylneuraminate-beta-1,4-ga...
ST3GAL3
276Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti38D → N in AAO38806 (Ref. 3) Curated1
Sequence conflicti94L → S in AAO38810 (Ref. 3) Curated1
Sequence conflicti123F → L in AAO38810 (Ref. 3) Curated1
Sequence conflicti351N → S in AAO38811 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06659413A → D in MRT12; most of the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function. 1 PublicationCorresponds to variant dbSNP:rs387906943EnsemblClinVar.1
Natural variantiVAR_069319320A → P in EIEE15. 1 Publication1
Natural variantiVAR_066595370D → Y in MRT12; the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function; shows a complete lack of enzyme activity; secretion of the mutant protein is dramatically reduced compared to wild-type. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01059540 – 73NSVVL…KLPAE → SSPSQHPCSWMTPFASGLES GSSCRLLGSKVKTI in isoform E3+32. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_01059440 – 56NSVVL…TLGSE → K in isoform C1, isoform C4, isoform C5, isoform C7, isoform C8, isoform C9, isoform C11 and isoform C12. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_01059340 – 55NSVVL…QTLGS → SKYSHSSSPQEKPVA in isoform D5 and isoform D2+26. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_01059240 – 43NSVV → SLLN in isoform E1. 1 Publication4
Alternative sequenceiVSP_01059140N → SKYSHSSSPQEKPVAD in isoform A1, isoform A7 and isoform A8. 1 Publication1
Alternative sequenceiVSP_01059644 – 375Missing in isoform E1. 1 PublicationAdd BLAST332
Alternative sequenceiVSP_01059770L → LSPRTLCTVVFGLDCILESP GEPKKLLMPASHPLEILKSL SEDTAFALGFLKLPR in isoform A8, isoform B8 and isoform C8. 1 Publication1
Alternative sequenceiVSP_01059871 – 101Missing in isoform B3 and isoform C11. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_01059974 – 375Missing in isoform E3+32. 1 PublicationAdd BLAST302
Alternative sequenceiVSP_010602102 – 121FSKPA…WARIR → AKRNGAWRQKHIQAYVLRQR in isoform B5+173. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_010601102 – 117FSKPA…SFRKW → PGRTISSERKSFCGSW in isoform C12. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_010600102 – 115FSKPA…DDSFR → EKVRTFMAWLAWYG in isoform B4+173. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_010603116 – 375Missing in isoform B4+173. 1 PublicationAdd BLAST260
Alternative sequenceiVSP_010604118 – 375Missing in isoform C12. 1 PublicationAdd BLAST258
Alternative sequenceiVSP_010605122 – 375Missing in isoform B5+173. 1 PublicationAdd BLAST254
Alternative sequenceiVSP_010607133 – 155DNLIK…ALDSL → VLDAQYPARERVSAEAGESS RHH in isoform A7, isoform B7 and isoform C7. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_010606133 – 151DNLIK…RLTPA → ECIGWLLEICGHSSAQGAP in isoform B10. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_010608152 – 375Missing in isoform B10. 1 PublicationAdd BLAST224
Alternative sequenceiVSP_010609156 – 375Missing in isoform A7, isoform B7 and isoform C7. 1 PublicationAdd BLAST220
Alternative sequenceiVSP_010610186 – 202RLNSA…DVGSK → SPGRTISSERKSFCGSW in isoform C5 and isoform D5. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_010613187 – 375Missing in isoform B5+26 and isoform D2+26. 1 PublicationAdd BLAST189
Alternative sequenceiVSP_010612187 – 244LNSAP…KYIVY → VHRMASGNLWPLECPRSPLR FESSTHISSRRPPSPSLACP STMASWAGGTSLPLAVWQ in isoform C9. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_010611187 – 189LNS → PRL in isoform B1+32. 1 Publication3
Alternative sequenceiVSP_010614190 – 375Missing in isoform B1+32. 1 PublicationAdd BLAST186
Alternative sequenceiVSP_010615203 – 375Missing in isoform C5 and isoform D5. 1 PublicationAdd BLAST173
Alternative sequenceiVSP_010616245 – 375Missing in isoform C9. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_010618249 – 346Missing in isoform B4, isoform C4 and isoform C11. 2 PublicationsAdd BLAST98
Alternative sequenceiVSP_010617249 – 278Missing in isoform B1-90. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L23768 mRNA Translation: AAA35778.1
AF425851 mRNA Translation: AAO13859.1
AF425852 mRNA Translation: AAO13860.1
AF425853 mRNA Translation: AAO13861.1
AF425854 mRNA Translation: AAO13862.1
AF425855 mRNA Translation: AAO13863.1
AF425856 mRNA Translation: AAO13864.1
AF425857 mRNA Translation: AAO13865.1
AF425858 mRNA Translation: AAO13866.1
AF425859 mRNA Translation: AAO13867.1
AF425860 mRNA Translation: AAO13868.1
AF425861 mRNA Translation: AAO13869.1
AF425862 mRNA Translation: AAO13870.1
AF425863 mRNA Translation: AAO13871.1
AF425864 mRNA Translation: AAO13872.1
AF425865 mRNA Translation: AAO13873.1
AF425866 mRNA Translation: AAO13874.1
AF425867 mRNA Translation: AAO13875.1
AF425868 mRNA Translation: AAO13876.1
AF425869 mRNA Translation: AAO13877.1
AY167992 mRNA Translation: AAO38806.1
AY167993 mRNA Translation: AAO38807.1
AY167994 mRNA Translation: AAO38808.1
AY167995 mRNA Translation: AAO38809.1
AY167996 mRNA Translation: AAO38810.1
AY167997 mRNA Translation: AAO38811.1
AY167998 mRNA Translation: AAO38812.1
AL357079 Genomic DNA No translation available.
AL451062 Genomic DNA No translation available.
AL592548 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07082.1
CH471059 Genomic DNA Translation: EAX07083.1
BC050380 mRNA Translation: AAH50380.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS492.1 [Q11203-1]
CCDS493.1 [Q11203-4]
CCDS494.1 [Q11203-2]
CCDS495.1 [Q11203-8]
CCDS496.1 [Q11203-13]
CCDS497.1 [Q11203-15]
CCDS498.1 [Q11203-19]
CCDS499.1 [Q11203-3]
CCDS500.1 [Q11203-12]
CCDS53310.1 [Q11203-18]
CCDS57988.1 [Q11203-5]
CCDS57989.1 [Q11203-7]
CCDS57990.1 [Q11203-16]
CCDS57991.1 [Q11203-17]
CCDS57992.1 [Q11203-22]
CCDS57993.1 [Q11203-24]
CCDS57994.1 [Q11203-23]
CCDS85964.1 [Q11203-21]

Protein sequence database of the Protein Information Resource

More...
PIRi
JN0618

NCBI Reference Sequences

More...
RefSeqi
NP_001257388.1, NM_001270459.1 [Q11203-5]
NP_001257389.1, NM_001270460.1 [Q11203-7]
NP_001257390.1, NM_001270461.1 [Q11203-16]
NP_001257391.1, NM_001270462.1 [Q11203-21]
NP_001257392.1, NM_001270463.1 [Q11203-24]
NP_001257393.1, NM_001270464.1 [Q11203-17]
NP_001257394.1, NM_001270465.1 [Q11203-23]
NP_001257395.1, NM_001270466.1 [Q11203-22]
NP_006270.1, NM_006279.3 [Q11203-1]
NP_777623.2, NM_174963.3 [Q11203-4]
NP_777624.1, NM_174964.2 [Q11203-2]
NP_777625.1, NM_174965.2 [Q11203-3]
NP_777626.1, NM_174966.2 [Q11203-8]
NP_777627.1, NM_174967.2 [Q11203-12]
NP_777628.2, NM_174968.3 [Q11203-13]
NP_777629.1, NM_174969.2 [Q11203-15]
NP_777630.1, NM_174970.2 [Q11203-18]
NP_777631.2, NM_174971.3 [Q11203-19]
XP_016857602.1, XM_017002113.1 [Q11203-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.597915
Hs.742205

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262915; ENSP00000262915; ENSG00000126091 [Q11203-4]
ENST00000330208; ENSP00000333494; ENSG00000126091 [Q11203-22]
ENST00000335430; ENSP00000335633; ENSG00000126091 [Q11203-23]
ENST00000347631; ENSP00000317192; ENSG00000126091 [Q11203-1]
ENST00000351035; ENSP00000316999; ENSG00000126091 [Q11203-13]
ENST00000353126; ENSP00000330463; ENSG00000126091 [Q11203-8]
ENST00000361392; ENSP00000355341; ENSG00000126091 [Q11203-2]
ENST00000361400; ENSP00000354748; ENSG00000126091 [Q11203-15]
ENST00000361812; ENSP00000355201; ENSG00000126091 [Q11203-3]
ENST00000372362; ENSP00000361437; ENSG00000126091 [Q11203-12]
ENST00000372365; ENSP00000361440; ENSG00000126091 [Q11203-10]
ENST00000372366; ENSP00000361441; ENSG00000126091 [Q11203-23]
ENST00000372367; ENSP00000361442; ENSG00000126091 [Q11203-24]
ENST00000372369; ENSP00000361444; ENSG00000126091 [Q11203-5]
ENST00000372372; ENSP00000361447; ENSG00000126091 [Q11203-19]
ENST00000372374; ENSP00000361449; ENSG00000126091 [Q11203-7]
ENST00000469715; ENSP00000431700; ENSG00000126091 [Q11203-26]
ENST00000489897; ENSP00000437206; ENSG00000126091 [Q11203-11]
ENST00000490541; ENSP00000435018; ENSG00000126091 [Q11203-25]
ENST00000528371; ENSP00000434876; ENSG00000126091 [Q11203-17]
ENST00000530581; ENSP00000437293; ENSG00000126091 [Q11203-20]
ENST00000531451; ENSP00000435603; ENSG00000126091 [Q11203-18]
ENST00000531816; ENSP00000434378; ENSG00000126091 [Q11203-22]
ENST00000531993; ENSP00000432682; ENSG00000126091 [Q11203-21]
ENST00000533212; ENSP00000435621; ENSG00000126091 [Q11203-14]
ENST00000533997; ENSP00000432071; ENSG00000126091 [Q11203-9]
ENST00000545417; ENSP00000439634; ENSG00000126091 [Q11203-3]
ENST00000642504; ENSP00000494857; ENSG00000126091 [Q11203-9]
ENST00000642934; ENSP00000494146; ENSG00000126091 [Q11203-16]
ENST00000642949; ENSP00000495709; ENSG00000126091 [Q11203-6]
ENST00000644195; ENSP00000494201; ENSG00000126091 [Q11203-1]
ENST00000645142; ENSP00000496550; ENSG00000126091 [Q11203-6]
ENST00000645165; ENSP00000493660; ENSG00000126091 [Q11203-11]
ENST00000645640; ENSP00000494852; ENSG00000126091 [Q11203-11]
ENST00000646971; ENSP00000495887; ENSG00000126091 [Q11203-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6487

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6487

UCSC genome browser

More...
UCSCi
uc001cjz.5 human [Q11203-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - GTase

ST3Gal III

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23768 mRNA Translation: AAA35778.1
AF425851 mRNA Translation: AAO13859.1
AF425852 mRNA Translation: AAO13860.1
AF425853 mRNA Translation: AAO13861.1
AF425854 mRNA Translation: AAO13862.1
AF425855 mRNA Translation: AAO13863.1
AF425856 mRNA Translation: AAO13864.1
AF425857 mRNA Translation: AAO13865.1
AF425858 mRNA Translation: AAO13866.1
AF425859 mRNA Translation: AAO13867.1
AF425860 mRNA Translation: AAO13868.1
AF425861 mRNA Translation: AAO13869.1
AF425862 mRNA Translation: AAO13870.1
AF425863 mRNA Translation: AAO13871.1
AF425864 mRNA Translation: AAO13872.1
AF425865 mRNA Translation: AAO13873.1
AF425866 mRNA Translation: AAO13874.1
AF425867 mRNA Translation: AAO13875.1
AF425868 mRNA Translation: AAO13876.1
AF425869 mRNA Translation: AAO13877.1
AY167992 mRNA Translation: AAO38806.1
AY167993 mRNA Translation: AAO38807.1
AY167994 mRNA Translation: AAO38808.1
AY167995 mRNA Translation: AAO38809.1
AY167996 mRNA Translation: AAO38810.1
AY167997 mRNA Translation: AAO38811.1
AY167998 mRNA Translation: AAO38812.1
AL357079 Genomic DNA No translation available.
AL451062 Genomic DNA No translation available.
AL592548 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07082.1
CH471059 Genomic DNA Translation: EAX07083.1
BC050380 mRNA Translation: AAH50380.1
CCDSiCCDS492.1 [Q11203-1]
CCDS493.1 [Q11203-4]
CCDS494.1 [Q11203-2]
CCDS495.1 [Q11203-8]
CCDS496.1 [Q11203-13]
CCDS497.1 [Q11203-15]
CCDS498.1 [Q11203-19]
CCDS499.1 [Q11203-3]
CCDS500.1 [Q11203-12]
CCDS53310.1 [Q11203-18]
CCDS57988.1 [Q11203-5]
CCDS57989.1 [Q11203-7]
CCDS57990.1 [Q11203-16]
CCDS57991.1 [Q11203-17]
CCDS57992.1 [Q11203-22]
CCDS57993.1 [Q11203-24]
CCDS57994.1 [Q11203-23]
CCDS85964.1 [Q11203-21]
PIRiJN0618
RefSeqiNP_001257388.1, NM_001270459.1 [Q11203-5]
NP_001257389.1, NM_001270460.1 [Q11203-7]
NP_001257390.1, NM_001270461.1 [Q11203-16]
NP_001257391.1, NM_001270462.1 [Q11203-21]
NP_001257392.1, NM_001270463.1 [Q11203-24]
NP_001257393.1, NM_001270464.1 [Q11203-17]
NP_001257394.1, NM_001270465.1 [Q11203-23]
NP_001257395.1, NM_001270466.1 [Q11203-22]
NP_006270.1, NM_006279.3 [Q11203-1]
NP_777623.2, NM_174963.3 [Q11203-4]
NP_777624.1, NM_174964.2 [Q11203-2]
NP_777625.1, NM_174965.2 [Q11203-3]
NP_777626.1, NM_174966.2 [Q11203-8]
NP_777627.1, NM_174967.2 [Q11203-12]
NP_777628.2, NM_174968.3 [Q11203-13]
NP_777629.1, NM_174969.2 [Q11203-15]
NP_777630.1, NM_174970.2 [Q11203-18]
NP_777631.2, NM_174971.3 [Q11203-19]
XP_016857602.1, XM_017002113.1 [Q11203-1]
UniGeneiHs.597915
Hs.742205

3D structure databases

ProteinModelPortaliQ11203
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112379, 10 interactors
IntActiQ11203, 5 interactors

Chemistry databases

ChEMBLiCHEMBL3596076

Protein family/group databases

CAZyiGT29 Glycosyltransferase Family 29

PTM databases

iPTMnetiQ11203
PhosphoSitePlusiQ11203

Polymorphism and mutation databases

BioMutaiST3GAL3
DMDMi1705561

Proteomic databases

PeptideAtlasiQ11203
PRIDEiQ11203
ProteomicsDBi58874
58875 [Q11203-10]
58876 [Q11203-11]
58877 [Q11203-12]
58878 [Q11203-13]
58879 [Q11203-14]
58880 [Q11203-15]
58881 [Q11203-16]
58882 [Q11203-17]
58883 [Q11203-18]
58884 [Q11203-19]
58885 [Q11203-2]
58886 [Q11203-20]
58887 [Q11203-21]
58888 [Q11203-22]
58889 [Q11203-23]
58890 [Q11203-24]
58891 [Q11203-25]
58892 [Q11203-26]
58893 [Q11203-3]
58894 [Q11203-4]
58895 [Q11203-5]
58896 [Q11203-6]
58897 [Q11203-7]
58898 [Q11203-8]
58899 [Q11203-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6487
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262915; ENSP00000262915; ENSG00000126091 [Q11203-4]
ENST00000330208; ENSP00000333494; ENSG00000126091 [Q11203-22]
ENST00000335430; ENSP00000335633; ENSG00000126091 [Q11203-23]
ENST00000347631; ENSP00000317192; ENSG00000126091 [Q11203-1]
ENST00000351035; ENSP00000316999; ENSG00000126091 [Q11203-13]
ENST00000353126; ENSP00000330463; ENSG00000126091 [Q11203-8]
ENST00000361392; ENSP00000355341; ENSG00000126091 [Q11203-2]
ENST00000361400; ENSP00000354748; ENSG00000126091 [Q11203-15]
ENST00000361812; ENSP00000355201; ENSG00000126091 [Q11203-3]
ENST00000372362; ENSP00000361437; ENSG00000126091 [Q11203-12]
ENST00000372365; ENSP00000361440; ENSG00000126091 [Q11203-10]
ENST00000372366; ENSP00000361441; ENSG00000126091 [Q11203-23]
ENST00000372367; ENSP00000361442; ENSG00000126091 [Q11203-24]
ENST00000372369; ENSP00000361444; ENSG00000126091 [Q11203-5]
ENST00000372372; ENSP00000361447; ENSG00000126091 [Q11203-19]
ENST00000372374; ENSP00000361449; ENSG00000126091 [Q11203-7]
ENST00000469715; ENSP00000431700; ENSG00000126091 [Q11203-26]
ENST00000489897; ENSP00000437206; ENSG00000126091 [Q11203-11]
ENST00000490541; ENSP00000435018; ENSG00000126091 [Q11203-25]
ENST00000528371; ENSP00000434876; ENSG00000126091 [Q11203-17]
ENST00000530581; ENSP00000437293; ENSG00000126091 [Q11203-20]
ENST00000531451; ENSP00000435603; ENSG00000126091 [Q11203-18]
ENST00000531816; ENSP00000434378; ENSG00000126091 [Q11203-22]
ENST00000531993; ENSP00000432682; ENSG00000126091 [Q11203-21]
ENST00000533212; ENSP00000435621; ENSG00000126091 [Q11203-14]
ENST00000533997; ENSP00000432071; ENSG00000126091 [Q11203-9]
ENST00000545417; ENSP00000439634; ENSG00000126091 [Q11203-3]
ENST00000642504; ENSP00000494857; ENSG00000126091 [Q11203-9]
ENST00000642934; ENSP00000494146; ENSG00000126091 [Q11203-16]
ENST00000642949; ENSP00000495709; ENSG00000126091 [Q11203-6]
ENST00000644195; ENSP00000494201; ENSG00000126091 [Q11203-1]
ENST00000645142; ENSP00000496550; ENSG00000126091 [Q11203-6]
ENST00000645165; ENSP00000493660; ENSG00000126091 [Q11203-11]
ENST00000645640; ENSP00000494852; ENSG00000126091 [Q11203-11]
ENST00000646971; ENSP00000495887; ENSG00000126091 [Q11203-1]
GeneIDi6487
KEGGihsa:6487
UCSCiuc001cjz.5 human [Q11203-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6487
DisGeNETi6487
EuPathDBiHostDB:ENSG00000126091.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ST3GAL3
HGNCiHGNC:10866 ST3GAL3
HPAiHPA051102
MalaCardsiST3GAL3
MIMi606494 gene
611090 phenotype
615006 phenotype
neXtProtiNX_Q11203
OpenTargetsiENSG00000126091
Orphaneti88616 Autosomal recessive non-syndromic intellectual disability
3451 West syndrome
PharmGKBiPA35768

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000157285
HOVERGENiHBG056676
InParanoidiQ11203
KOiK00781
OMAiEGVCKPG
OrthoDBi1358010at2759
PhylomeDBiQ11203
TreeFamiTF354325

Enzyme and pathway databases

UniPathwayi
UPA00378

BioCyciMetaCyc:HS04994-MONOMER
BRENDAi2.4.99.6 2681
ReactomeiR-HSA-1912420 Pre-NOTCH Processing in Golgi
R-HSA-2022854 Keratan sulfate biosynthesis
R-HSA-3656243 Defective ST3GAL3 causes MCT12 and EIEE15
R-HSA-4085001 Sialic acid metabolism
R-HSA-977068 Termination of O-glycan biosynthesis
SIGNORiQ11203

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ST3GAL3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ST3GAL3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6487

Protein Ontology

More...
PROi
PR:Q11203

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000126091 Expressed in 171 organ(s), highest expression level in pituitary gland
ExpressionAtlasiQ11203 baseline and differential
GenevisibleiQ11203 HS

Family and domain databases

Gene3Di3.90.1480.20, 1 hit
InterProiView protein in InterPro
IPR001675 Glyco_trans_29
IPR038578 GT29-like_sf
IPR012163 Sialyl_trans
PfamiView protein in Pfam
PF00777 Glyco_transf_29, 1 hit
PIRSFiPIRSF005557 Sialyl_trans, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSIAT6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q11203
Secondary accession number(s): A9Z1W2
, D3DPX8, Q5T4W9, Q5T4X0, Q5T4X7, Q5T4X8, Q5T4X9, Q5T4Y0, Q5T4Y2, Q5T4Y3, Q5T4Y4, Q86UR6, Q86UR7, Q86UR8, Q86UR9, Q86US0, Q86US1, Q86US2, Q8IX41, Q8IX42, Q8IX43, Q8IX44, Q8IX45, Q8IX46, Q8IX47, Q8IX48, Q8IX49, Q8IX50, Q8IX51, Q8IX52, Q8IX53, Q8IX54, Q8IX55, Q8IX56, Q8IX57, Q8IX58
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: January 16, 2019
This is version 178 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again