Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 198 (05 Jun 2019)
Sequence version 2 (31 Oct 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Acetyl-CoA carboxylase 1

Gene

ACACA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

By phosphorylation (By similarity). Activity is increased by oligomerization. Citrate and MID1IP1 promote oligomerization.By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: malonyl-CoA biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes malonyl-CoA from acetyl-CoA.
Proteins known to be involved in this subpathway in this organism are:
  1. Acetyl-CoA carboxylase 2 (ACACB), Acetyl-CoA carboxylase 1 (ACACA)
This subpathway is part of the pathway malonyl-CoA biosynthesis, which is itself part of Lipid metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes malonyl-CoA from acetyl-CoA, the pathway malonyl-CoA biosynthesis and in Lipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi424Manganese 1By similarity1
Metal bindingi437Manganese 1By similarity1
Metal bindingi437Manganese 2By similarity1
Metal bindingi439Manganese 2By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei441By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei1823Coenzyme ABy similarity1
Binding sitei2127Coenzyme ABy similarity1
Binding sitei2129Coenzyme ABy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi315 – 320ATPPROSITE-ProRule annotation6

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAllosteric enzyme, Ligase, Multifunctional enzyme
Biological processFatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism
LigandATP-binding, Biotin, Manganese, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS05598-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
6.4.1.2 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-163765 ChREBP activates metabolic gene expression
R-HSA-196780 Biotin transport and metabolism
R-HSA-200425 Import of palmitoyl-CoA into the mitochondrial matrix
R-HSA-2426168 Activation of gene expression by SREBF (SREBP)
R-HSA-3371599 Defective HLCS causes multiple carboxylase deficiency
R-HSA-75105 Fatty acyl-CoA biosynthesis

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q13085

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q13085

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00655;UER00711

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000729

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Acetyl-CoA carboxylase 1 (EC:6.4.1.21 Publication)
Short name:
ACC1
Alternative name(s):
Acetyl-Coenzyme A carboxylase alpha
Short name:
ACC-alpha
Including the following 1 domains:
Biotin carboxylase (EC:6.3.4.141 Publication)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACACA
Synonyms:ACAC, ACC1, ACCA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:84 ACACA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
200350 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13085

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Acetyl-CoA carboxylase 1 deficiency (ACACAD)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn inborn error of de novo fatty acid synthesis associated with severe brain damage, persistent myopathy and poor growth.
Related information in OMIM

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi78S → A: No effect on interaction with BRCA1. 1 Publication1
Mutagenesisi344S → A: No effect on interaction with BRCA1. 1 Publication1
Mutagenesisi432S → A: No effect on interaction with BRCA1. 1 Publication1
Mutagenesisi1201S → A: No effect on interaction with BRCA1. 1 Publication1
Mutagenesisi1263S → A: Abolishes interaction with BRCA1. 1 Publication1
Mutagenesisi1585S → A: No effect on interaction with BRCA1. 1 Publication1
Mutagenesisi1952S → A: No effect on interaction with BRCA1. 1 Publication1
Mutagenesisi2211S → A: No effect on interaction with BRCA1. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
31

MalaCards human disease database

More...
MalaCardsi
ACACA
MIMi613933 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000278540

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24421

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3351

Drug and drug target database

More...
DrugBanki
DB00121 Biotin

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1263

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ACACA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
118601083

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001467641 – 2346Acetyl-CoA carboxylase 1Add BLAST2346

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei5PhosphoserineCombined sources1
Modified residuei23PhosphoserineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei29PhosphoserineCombined sources1
Modified residuei34PhosphoserineBy similarity1
Modified residuei48PhosphoserineCombined sources1
Modified residuei50PhosphoserineBy similarity1
Modified residuei53PhosphoserineCombined sources1
Modified residuei58PhosphothreonineBy similarity1
Modified residuei78PhosphoserineBy similarity1
Modified residuei80PhosphoserineCombined sources1 Publication1
Modified residuei488PhosphoserineCombined sources1
Modified residuei610PhosphothreonineCombined sources1
Modified residuei786N6-biotinyllysinePROSITE-ProRule annotationBy similarity1
Modified residuei835PhosphoserineCombined sources1
Modified residuei1201PhosphoserineBy similarity1
Modified residuei1216PhosphoserineBy similarity1
Modified residuei1218PhosphoserineBy similarity1
Modified residuei1227PhosphothreonineBy similarity1
Modified residuei1259PhosphoserineBy similarity1
Modified residuei1263Phosphoserine1 Publication1
Modified residuei1273PhosphoserineCombined sources1
Modified residuei1334N6-acetyllysineCombined sources1
Modified residuei2153PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation on Ser-1263 is required for interaction with BRCA1.2 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q13085

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q13085

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13085

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13085

PeptideAtlas

More...
PeptideAtlasi
Q13085

PRoteomics IDEntifications database

More...
PRIDEi
Q13085

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59139
59140 [Q13085-2]
59141 [Q13085-3]
59142 [Q13085-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13085

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13085

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q13085

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, placental, skeletal muscle, renal, pancreatic and adipose tissues; expressed at low level in pulmonary tissue; not detected in the liver.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000278540 Expressed in 219 organ(s), highest expression level in adrenal tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q13085 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13085 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB013715
HPA036650
HPA063018

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer, homodimer, and homotetramer. Can form filamentous polymers. Interacts in its inactive phosphorylated form with the BRCT domains of BRCA1 which prevents ACACA dephosphorylation and inhibits lipid synthesis. Interacts with MID1IP1; interaction with MID1IP1 promotes oligomerization and increases its activity.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106549, 93 interactors

Database of interacting proteins

More...
DIPi
DIP-36122N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q13085

Protein interaction database and analysis system

More...
IntActi
Q13085, 41 interactors

Molecular INTeraction database

More...
MINTi
Q13085

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000483300

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q13085

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12346
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13085

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q13085

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini117 – 618Biotin carboxylationAdd BLAST502
Domaini275 – 466ATP-graspPROSITE-ProRule annotationAdd BLAST192
Domaini745 – 819Biotinyl-bindingPROSITE-ProRule annotationAdd BLAST75
Domaini1576 – 1914CoA carboxyltransferase N-terminalPROSITE-ProRule annotationAdd BLAST339
Domaini1918 – 2234CoA carboxyltransferase C-terminalPROSITE-ProRule annotationAdd BLAST317

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1576 – 2234CarboxyltransferasePROSITE-ProRule annotationAdd BLAST659

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0368 Eukaryota
COG0439 LUCA
COG0511 LUCA
COG4799 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156706

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13085

KEGG Orthology (KO)

More...
KOi
K11262

Identification of Orthologs from Complete Genome Data

More...
OMAi
LPYGEWN

Database of Orthologous Groups

More...
OrthoDBi
1270467at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13085

TreeFam database of animal gene trees

More...
TreeFami
TF300061

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1490.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR034733 AcCoA_carboxyl
IPR013537 AcCoA_COase_cen
IPR011761 ATP-grasp
IPR013815 ATP_grasp_subdomain_1
IPR005481 BC-like_N
IPR001882 Biotin_BS
IPR011764 Biotin_carboxylation_dom
IPR005482 Biotin_COase_C
IPR000089 Biotin_lipoyl
IPR005479 CbamoylP_synth_lsu-like_ATP-bd
IPR029045 ClpP/crotonase-like_dom_sf
IPR011763 COA_CT_C
IPR011762 COA_CT_N
IPR016185 PreATP-grasp_dom_sf
IPR011054 Rudment_hybrid_motif
IPR011053 Single_hybrid_motif

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08326 ACC_central, 1 hit
PF02785 Biotin_carb_C, 1 hit
PF00289 Biotin_carb_N, 1 hit
PF00364 Biotin_lipoyl, 1 hit
PF01039 Carboxyl_trans, 1 hit
PF02786 CPSase_L_D2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00878 Biotin_carb_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51230 SSF51230, 1 hit
SSF51246 SSF51246, 1 hit
SSF52096 SSF52096, 2 hits
SSF52440 SSF52440, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50975 ATP_GRASP, 1 hit
PS50979 BC, 1 hit
PS00188 BIOTIN, 1 hit
PS50968 BIOTINYL_LIPOYL, 1 hit
PS50989 COA_CT_CTER, 1 hit
PS50980 COA_CT_NTER, 1 hit
PS00866 CPSASE_1, 1 hit
PS00867 CPSASE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13085-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDEPSPLAQP LELNQHSRFI IGSVSEDNSE DEISNLVKLD LLEEKEGSLS
60 70 80 90 100
PASVGSDTLS DLGISSLQDG LALHIRSSMS GLHLVKQGRD RKKIDSQRDF
110 120 130 140 150
TVASPAEFVT RFGGNKVIEK VLIANNGIAA VKCMRSIRRW SYEMFRNERA
160 170 180 190 200
IRFVVMVTPE DLKANAEYIK MADHYVPVPG GPNNNNYANV ELILDIAKRI
210 220 230 240 250
PVQAVWAGWG HASENPKLPE LLLKNGIAFM GPPSQAMWAL GDKIASSIVA
260 270 280 290 300
QTAGIPTLPW SGSGLRVDWQ ENDFSKRILN VPQELYEKGY VKDVDDGLQA
310 320 330 340 350
AEEVGYPVMI KASEGGGGKG IRKVNNADDF PNLFRQVQAE VPGSPIFVMR
360 370 380 390 400
LAKQSRHLEV QILADQYGNA ISLFGRDCSV QRRHQKIIEE APATIATPAV
410 420 430 440 450
FEHMEQCAVK LAKMVGYVSA GTVEYLYSQD GSFYFLELNP RLQVEHPCTE
460 470 480 490 500
MVADVNLPAA QLQIAMGIPL YRIKDIRMMY GVSPWGDSPI DFEDSAHVPC
510 520 530 540 550
PRGHVIAARI TSENPDEGFK PSSGTVQELN FRSNKNVWGY FSVAAAGGLH
560 570 580 590 600
EFADSQFGHC FSWGENREEA ISNMVVALKE LSIRGDFRTT VEYLIKLLET
610 620 630 640 650
ESFQMNRIDT GWLDRLIAEK VQAERPDTML GVVCGALHVA DVSLRNSVSN
660 670 680 690 700
FLHSLERGQV LPAHTLLNTV DVELIYEGVK YVLKVTRQSP NSYVVIMNGS
710 720 730 740 750
CVEVDVHRLS DGGLLLSYDG SSYTTYMKEE VDRYRITIGN KTCVFEKEND
760 770 780 790 800
PSVMRSPSAG KLIQYIVEDG GHVFAGQCYA EIEVMKMVMT LTAVESGCIH
810 820 830 840 850
YVKRPGAALD PGCVLAKMQL DNPSKVQQAE LHTGSLPRIQ STALRGEKLH
860 870 880 890 900
RVFHYVLDNL VNVMNGYCLP DPFFSSKVKD WVERLMKTLR DPSLPLLELQ
910 920 930 940 950
DIMTSVSGRI PPNVEKSIKK EMAQYASNIT SVLCQFPSQQ IANILDSHAA
960 970 980 990 1000
TLNRKSEREV FFMNTQSIVQ LVQRYRSGIR GHMKAVVMDL LRQYLRVETQ
1010 1020 1030 1040 1050
FQNGHYDKCV FALREENKSD MNTVLNYIFS HAQVTKKNLL VTMLIDQLCG
1060 1070 1080 1090 1100
RDPTLTDELL NILTELTQLS KTTNAKVALR ARQVLIASHL PSYELRHNQV
1110 1120 1130 1140 1150
ESIFLSAIDM YGHQFCIENL QKLILSETSI FDVLPNFFYH SNQVVRMAAL
1160 1170 1180 1190 1200
EVYVRRAYIA YELNSVQHRQ LKDNTCVVEF QFMLPTSHPN RGNIPTLNRM
1210 1220 1230 1240 1250
SFSSNLNHYG MTHVASVSDV LLDNSFTPPC QRMGGMVSFR TFEDFVRIFD
1260 1270 1280 1290 1300
EVMGCFSDSP PQSPTFPEAG HTSLYDEDKV PRDEPIHILN VAIKTDCDIE
1310 1320 1330 1340 1350
DDRLAAMFRE FTQQNKATLV DHGIRRLTFL VAQKDFRKQV NYEVDRRFHR
1360 1370 1380 1390 1400
EFPKFFTFRA RDKFEEDRIY RHLEPALAFQ LELNRMRNFD LTAIPCANHK
1410 1420 1430 1440 1450
MHLYLGAAKV EVGTEVTDYR FFVRAIIRHS DLVTKEASFE YLQNEGERLL
1460 1470 1480 1490 1500
LEAMDELEVA FNNTNVRTDC NHIFLNFVPT VIMDPSKIEE SVRSMVMRYG
1510 1520 1530 1540 1550
SRLWKLRVLQ AELKINIRLT PTGKAIPIRL FLTNESGYYL DISLYKEVTD
1560 1570 1580 1590 1600
SRTAQIMFQA YGDKQGPLHG MLINTPYVTK DLLQSKRFQA QSLGTTYIYD
1610 1620 1630 1640 1650
IPEMFRQSLI KLWESMSTQA FLPSPPLPSD MLTYTELVLD DQGQLVHMNR
1660 1670 1680 1690 1700
LPGGNEIGMV AWKMTFKSPE YPEGRDIIVI GNDITYRIGS FGPQEDLLFL
1710 1720 1730 1740 1750
RASELARAEG IPRIYVSANS GARIGLAEEI RHMFHVAWVD PEDPYKGYRY
1760 1770 1780 1790 1800
LYLTPQDYKR VSALNSVHCE HVEDEGESRY KITDIIGKEE GIGPENLRGS
1810 1820 1830 1840 1850
GMIAGESSLA YNEIITISLV TCRAIGIGAY LVRLGQRTIQ VENSHLILTG
1860 1870 1880 1890 1900
AGALNKVLGR EVYTSNNQLG GIQIMHNNGV THCTVCDDFE GVFTVLHWLS
1910 1920 1930 1940 1950
YMPKSVHSSV PLLNSKDPID RIIEFVPTKT PYDPRWMLAG RPHPTQKGQW
1960 1970 1980 1990 2000
LSGFFDYGSF SEIMQPWAQT VVVGRARLGG IPVGVVAVET RTVELSIPAD
2010 2020 2030 2040 2050
PANLDSEAKI IQQAGQVWFP DSAFKTYQAI KDFNREGLPL MVFANWRGFS
2060 2070 2080 2090 2100
GGMKDMYDQV LKFGAYIVDG LRECCQPVLV YIPPQAELRG GSWVVIDSSI
2110 2120 2130 2140 2150
NPRHMEMYAD RESRGSVLEP EGTVEIKFRR KDLVKTMRRV DPVYIHLAER
2160 2170 2180 2190 2200
LGTPELSTAE RKELENKLKE REEFLIPIYH QVAVQFADLH DTPGRMQEKG
2210 2220 2230 2240 2250
VISDILDWKT SRTFFYWRLR RLLLEDLVKK KIHNANPELT DGQIQAMLRR
2260 2270 2280 2290 2300
WFVEVEGTVK AYVWDNNKDL AEWLEKQLTE EDGVHSVIEE NIKCISRDYV
2310 2320 2330 2340
LKQIRSLVQA NPEVAMDSII HMTQHISPTQ RAEVIRILST MDSPST
Length:2,346
Mass (Da):265,554
Last modified:October 31, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF1F0A518F8824FFC
GO
Isoform 2 (identifier: Q13085-2) [UniParc]FASTAAdd to basket
Also known as: E5A

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: MDEPSPLAQP...SLQDGLALHI → MEGSPEENKEMRYYMLQ

Show »
Length:2,288
Mass (Da):259,686
Checksum:i4E2C75958216CC8B
GO
Isoform 3 (identifier: Q13085-3) [UniParc]FASTAAdd to basket
Also known as: E5B

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.

Show »
Length:2,268
Mass (Da):257,239
Checksum:iC78033F62C492D3E
GO
Isoform 4 (identifier: Q13085-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIM

Show »
Length:2,383
Mass (Da):269,999
Checksum:i1F2B8F96208B9983
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X126A0A087X126_HUMAN
Acetyl-CoA carboxylase 1
ACACA
112Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGT1A0A0C4DGT1_HUMAN
Acetyl-CoA carboxylase 1
ACACA
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q59FY4Q59FY4_HUMAN
Acetyl-CoA carboxylase 1
ACACA
998Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X0W4A0A087X0W4_HUMAN
Acetyl-CoA carboxylase 1
ACACA
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWN5A0A087WWN5_HUMAN
Acetyl-CoA carboxylase 1
ACACA
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYK6A0A087WYK6_HUMAN
Acetyl-CoA carboxylase 1
ACACA
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYS8A0A087WYS8_HUMAN
Acetyl-CoA carboxylase 1
ACACA
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WVR6A0A087WVR6_HUMAN
Acetyl-CoA carboxylase 1
ACACA
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X2F8A0A087X2F8_HUMAN
Acetyl-CoA carboxylase 1
ACACA
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti66S → A in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti79M → W in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti89R → G in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti182P → A in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti234S → N in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti299Q → K in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti303E → K in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti364A → V in AAP94122 (PubMed:12810950).Curated1
Sequence conflicti446H → Q in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti494D → N in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti554D → G in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti622Q → R in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti640A → G in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti814V → I in AAP94122 (PubMed:12810950).Curated1
Sequence conflicti1061N → S in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1094 – 1095EL → DV in AAC50139 (PubMed:7732023).Curated2
Sequence conflicti1225S → A in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1257S → C in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1297C → G in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1320V → A in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1444N → S in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1474F → L in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1665 – 1666TF → SL in AAC50139 (PubMed:7732023).Curated2
Sequence conflicti1677I → V in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1741P → S in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1762S → G in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1822C → S in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1875M → T in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1888D → G in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti1997I → V in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti2013Q → H in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti2058D → H in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti2075C → S in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti2098 – 2099SS → PT in AAC50139 (PubMed:7732023).Curated2
Sequence conflicti2158 – 2159TA → PT in AAC50139 (PubMed:7732023).Curated2
Sequence conflicti2166N → S in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti2234N → S in AAC50139 (PubMed:7732023).Curated1
Sequence conflicti2321H → R in AAP94122 (PubMed:12810950).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_042941838R → W. Corresponds to variant dbSNP:rs2287351Ensembl.1
Natural variantiVAR_0365141687R → Q in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1357271377Ensembl.1
Natural variantiVAR_0289292271A → V Rare polymorphism; frequency <0.004; may play a role in breast cancer susceptibility. 1 PublicationCorresponds to variant dbSNP:rs146351326Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0260981 – 78Missing in isoform 3. 2 PublicationsAdd BLAST78
Alternative sequenceiVSP_0260991 – 75MDEPS…LALHI → MEGSPEENKEMRYYMLQ in isoform 2. 2 PublicationsAdd BLAST75
Alternative sequenceiVSP_0261001M → MWWSTLMSILRARSFWKWIS TQTVRIIRAVRAHFGGIM in isoform 4. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U19822 mRNA Translation: AAC50139.1
AY315619 mRNA Translation: AAP94114.1
AY315620 mRNA Translation: AAP94115.1
AY315621 mRNA Translation: AAP94116.1
AY315623 mRNA Translation: AAP94118.1
AY315627 mRNA Translation: AAP94122.1
AY237919 mRNA Translation: AAP69841.1
AB371587 mRNA Translation: BAG48316.1
CH471199 Genomic DNA Translation: EAW57582.1
CH471199 Genomic DNA Translation: EAW57577.1
CH471199 Genomic DNA Translation: EAW57578.1
CH471199 Genomic DNA Translation: EAW57581.1
BC137287 mRNA Translation: AAI37288.1
AJ534888 mRNA Translation: CAD59556.1
AJ534889 mRNA Translation: CAD59557.1
AJ564444 mRNA Translation: CAD92089.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11317.1 [Q13085-1]
CCDS11318.1 [Q13085-2]
CCDS42302.1 [Q13085-4]
CCDS42303.1 [Q13085-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
I38928

NCBI Reference Sequences

More...
RefSeqi
NP_942131.1, NM_198834.2 [Q13085-4]
NP_942133.1, NM_198836.2 [Q13085-1]
NP_942134.1, NM_198837.1 [Q13085-2]
NP_942135.1, NM_198838.1 [Q13085-3]
NP_942136.1, NM_198839.2 [Q13085-1]
XP_011523005.1, XM_011524703.1 [Q13085-1]
XP_016880044.1, XM_017024555.1 [Q13085-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000611803; ENSP00000479901; ENSG00000275176 [Q13085-2]
ENST00000612895; ENSP00000482269; ENSG00000278540 [Q13085-2]
ENST00000613687; ENSP00000483674; ENSG00000275176 [Q13085-1]
ENST00000614428; ENSP00000478547; ENSG00000278540 [Q13085-1]
ENST00000616317; ENSP00000483300; ENSG00000278540 [Q13085-4]
ENST00000617649; ENSP00000482368; ENSG00000278540 [Q13085-3]
ENST00000619487; ENSP00000478577; ENSG00000275176 [Q13085-4]
ENST00000621312; ENSP00000480031; ENSG00000275176 [Q13085-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
31

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:31

UCSC genome browser

More...
UCSCi
uc002hnk.4 human [Q13085-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Acetyl-CoA carboxylase entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U19822 mRNA Translation: AAC50139.1
AY315619 mRNA Translation: AAP94114.1
AY315620 mRNA Translation: AAP94115.1
AY315621 mRNA Translation: AAP94116.1
AY315623 mRNA Translation: AAP94118.1
AY315627 mRNA Translation: AAP94122.1
AY237919 mRNA Translation: AAP69841.1
AB371587 mRNA Translation: BAG48316.1
CH471199 Genomic DNA Translation: EAW57582.1
CH471199 Genomic DNA Translation: EAW57577.1
CH471199 Genomic DNA Translation: EAW57578.1
CH471199 Genomic DNA Translation: EAW57581.1
BC137287 mRNA Translation: AAI37288.1
AJ534888 mRNA Translation: CAD59556.1
AJ534889 mRNA Translation: CAD59557.1
AJ564444 mRNA Translation: CAD92089.1
CCDSiCCDS11317.1 [Q13085-1]
CCDS11318.1 [Q13085-2]
CCDS42302.1 [Q13085-4]
CCDS42303.1 [Q13085-3]
PIRiI38928
RefSeqiNP_942131.1, NM_198834.2 [Q13085-4]
NP_942133.1, NM_198836.2 [Q13085-1]
NP_942134.1, NM_198837.1 [Q13085-2]
NP_942135.1, NM_198838.1 [Q13085-3]
NP_942136.1, NM_198839.2 [Q13085-1]
XP_011523005.1, XM_011524703.1 [Q13085-1]
XP_016880044.1, XM_017024555.1 [Q13085-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YL2X-ray2.30A/B78-617[»]
3COJX-ray3.21H/I/J/K/L/M/N/O1258-1270[»]
4ASIX-ray2.80A/B/C/D/E/F1571-2338[»]
6G2Delectron microscopy5.40B/C/D/F1-2346[»]
6G2Helectron microscopy4.60A/B/C/D/E/F1-2346[»]
6G2Ielectron microscopy5.90A/B/C/D/E/F/G/J/Q/R1-2346[»]
SMRiQ13085
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106549, 93 interactors
DIPiDIP-36122N
ELMiQ13085
IntActiQ13085, 41 interactors
MINTiQ13085
STRINGi9606.ENSP00000483300

Chemistry databases

BindingDBiQ13085
ChEMBLiCHEMBL3351
DrugBankiDB00121 Biotin
GuidetoPHARMACOLOGYi1263
SwissLipidsiSLP:000000729

PTM databases

iPTMnetiQ13085
PhosphoSitePlusiQ13085
SwissPalmiQ13085

Polymorphism and mutation databases

BioMutaiACACA
DMDMi118601083

Proteomic databases

EPDiQ13085
jPOSTiQ13085
MaxQBiQ13085
PaxDbiQ13085
PeptideAtlasiQ13085
PRIDEiQ13085
ProteomicsDBi59139
59140 [Q13085-2]
59141 [Q13085-3]
59142 [Q13085-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000611803; ENSP00000479901; ENSG00000275176 [Q13085-2]
ENST00000612895; ENSP00000482269; ENSG00000278540 [Q13085-2]
ENST00000613687; ENSP00000483674; ENSG00000275176 [Q13085-1]
ENST00000614428; ENSP00000478547; ENSG00000278540 [Q13085-1]
ENST00000616317; ENSP00000483300; ENSG00000278540 [Q13085-4]
ENST00000617649; ENSP00000482368; ENSG00000278540 [Q13085-3]
ENST00000619487; ENSP00000478577; ENSG00000275176 [Q13085-4]
ENST00000621312; ENSP00000480031; ENSG00000275176 [Q13085-3]
GeneIDi31
KEGGihsa:31
UCSCiuc002hnk.4 human [Q13085-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
31
DisGeNETi31

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ACACA
HGNCiHGNC:84 ACACA
HPAiCAB013715
HPA036650
HPA063018
MalaCardsiACACA
MIMi200350 gene
613933 phenotype
neXtProtiNX_Q13085
OpenTargetsiENSG00000278540
PharmGKBiPA24421

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0368 Eukaryota
COG0439 LUCA
COG0511 LUCA
COG4799 LUCA
GeneTreeiENSGT00940000156706
InParanoidiQ13085
KOiK11262
OMAiLPYGEWN
OrthoDBi1270467at2759
PhylomeDBiQ13085
TreeFamiTF300061

Enzyme and pathway databases

UniPathwayiUPA00655;UER00711
BioCyciMetaCyc:HS05598-MONOMER
BRENDAi6.4.1.2 2681
ReactomeiR-HSA-163765 ChREBP activates metabolic gene expression
R-HSA-196780 Biotin transport and metabolism
R-HSA-200425 Import of palmitoyl-CoA into the mitochondrial matrix
R-HSA-2426168 Activation of gene expression by SREBF (SREBP)
R-HSA-3371599 Defective HLCS causes multiple carboxylase deficiency
R-HSA-75105 Fatty acyl-CoA biosynthesis
SABIO-RKiQ13085
SIGNORiQ13085

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ACACA human
EvolutionaryTraceiQ13085

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ACACA

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
31

Protein Ontology

More...
PROi
PR:Q13085

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000278540 Expressed in 219 organ(s), highest expression level in adrenal tissue
ExpressionAtlasiQ13085 baseline and differential
GenevisibleiQ13085 HS

Family and domain databases

Gene3Di3.30.1490.20, 1 hit
InterProiView protein in InterPro
IPR034733 AcCoA_carboxyl
IPR013537 AcCoA_COase_cen
IPR011761 ATP-grasp
IPR013815 ATP_grasp_subdomain_1
IPR005481 BC-like_N
IPR001882 Biotin_BS
IPR011764 Biotin_carboxylation_dom
IPR005482 Biotin_COase_C
IPR000089 Biotin_lipoyl
IPR005479 CbamoylP_synth_lsu-like_ATP-bd
IPR029045 ClpP/crotonase-like_dom_sf
IPR011763 COA_CT_C
IPR011762 COA_CT_N
IPR016185 PreATP-grasp_dom_sf
IPR011054 Rudment_hybrid_motif
IPR011053 Single_hybrid_motif
PfamiView protein in Pfam
PF08326 ACC_central, 1 hit
PF02785 Biotin_carb_C, 1 hit
PF00289 Biotin_carb_N, 1 hit
PF00364 Biotin_lipoyl, 1 hit
PF01039 Carboxyl_trans, 1 hit
PF02786 CPSase_L_D2, 1 hit
SMARTiView protein in SMART
SM00878 Biotin_carb_C, 1 hit
SUPFAMiSSF51230 SSF51230, 1 hit
SSF51246 SSF51246, 1 hit
SSF52096 SSF52096, 2 hits
SSF52440 SSF52440, 1 hit
PROSITEiView protein in PROSITE
PS50975 ATP_GRASP, 1 hit
PS50979 BC, 1 hit
PS00188 BIOTIN, 1 hit
PS50968 BIOTINYL_LIPOYL, 1 hit
PS50989 COA_CT_CTER, 1 hit
PS50980 COA_CT_NTER, 1 hit
PS00866 CPSASE_1, 1 hit
PS00867 CPSASE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACACA_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13085
Secondary accession number(s): B2RP68
, B2ZZ90, Q6KEV6, Q6XDA8, Q7Z2G8, Q7Z561, Q7Z563, Q7Z564, Q86WB2, Q86WB3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 31, 2006
Last modified: June 5, 2019
This is version 198 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again