Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 205 (31 Jul 2019)
Sequence version 4 (13 Jul 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Disintegrin and metalloproteinase domain-containing protein 15

Gene

ADAM15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-mediated cell adhesion and migration of airway smooth muscle cells. Suppresses cell motility on or towards fibronectin possibly by driving alpha-v/beta-1 integrin (ITAGV-ITGB1) cell surface expression via ERK1/2 inactivation. Cleaves E-cadherin in response to growth factor deprivation. Plays a role in glomerular cell migration. Plays a role in pathological neovascularization. May play a role in cartilage remodeling. May be proteolytically processed, during sperm epididymal maturation and the acrosome reaction. May play a role in sperm-egg binding through its disintegrin domain.7 Publications

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by hydroxamate-type metalloproteinase inhibitors such as marimastat. Inhibited by metalloproteinase inhibitor 2 (TIMP-2) and TIMP-3 at nanomolar concentrations. Not significantly inhibited by TIMP-1 at concentrations of up to 100 nM. Not activated by PMA or ionomycin.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi179Zinc; in inhibited formBy similarity1
Metal bindingi348Zinc; catalyticBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei349PROSITE-ProRule annotation1
Metal bindingi352Zinc; catalyticBy similarity1
Metal bindingi358Zinc; catalyticBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • SH3 domain binding Source: BHF-UCL
  • integrin binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • metalloendopeptidase activity Source: InterPro
  • metallopeptidase activity Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processAngiogenesis, Cell adhesion, Collagen degradation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1474228 Degradation of the extracellular matrix
R-HSA-8941237 Invadopodia formation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q13444

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M12.215

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 15 (EC:3.4.24.-)
Short name:
ADAM 15
Alternative name(s):
Metalloprotease RGD disintegrin protein
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15
Short name:
MDC-15
Metargidin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADAM15
Synonyms:MDC15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:193 ADAM15

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605548 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13444

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini207 – 696ExtracellularSequence analysisAdd BLAST490
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei697 – 717HelicalSequence analysisAdd BLAST21
Topological domaini718 – 863CytoplasmicSequence analysisAdd BLAST146

Keywords - Cellular componenti

Cell junction, Cell projection, Cilium, Cytoplasmic vesicle, Flagellum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi484 – 485RG → SV: Reduces ADAM15-mediated T-cell aggregation. 1 Publication2

Organism-specific databases

DisGeNET

More...
DisGeNETi
8751

Open Targets

More...
OpenTargetsi
ENSG00000143537

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24510

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2331050

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ADAM15

Domain mapping of disease mutations (DMDM)

More...
DMDMi
300669614

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 17Sequence analysisAdd BLAST17
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002908218 – 206By similarityAdd BLAST189
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000029083207 – 863Disintegrin and metalloproteinase domain-containing protein 15Add BLAST657

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi237N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi323 ↔ 409By similarity
Disulfide bondi365 ↔ 393By similarity
Disulfide bondi367 ↔ 376By similarity
Glycosylationi389N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi392N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi480 ↔ 500By similarity
Glycosylationi606N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi611N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi657 ↔ 667By similarity
Disulfide bondi661 ↔ 673By similarity
Disulfide bondi675 ↔ 684By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei715Phosphotyrosine; by HCK and LCK1 Publication1
Modified residuei735Phosphotyrosine; by HCK and LCK1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity
Phosphorylation increases association with PTKs.1 Publication

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein, Zymogen

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q13444

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q13444

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13444

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13444

PeptideAtlas

More...
PeptideAtlasi
Q13444

PRoteomics IDEntifications database

More...
PRIDEi
Q13444

ProteomicsDB human proteome resource

More...
ProteomicsDBi
22321
59442 [Q13444-1]
59443 [Q13444-10]
59444 [Q13444-11]
59445 [Q13444-2]
59446 [Q13444-3]
59447 [Q13444-4]
59448 [Q13444-5]
59449 [Q13444-6]
59450 [Q13444-7]
59451 [Q13444-8]
59452 [Q13444-9]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1179

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13444

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13444

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in colon and small intestine. Expressed in airway smooth muscle and glomerular mesangial cells (at protein level). Ubiquitously expressed. Overexpressed in atherosclerotic lesions. Constitutively expressed in cultured endothelium and smooth muscle. Expressed in chondrocytes. Expressed in airway smooth muscle and glomerular mesangial cells.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143537 Expressed in 144 organ(s), highest expression level in left lobe of thyroid gland

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13444 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA011633
HPA072878

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ITAGV-ITGB3 (vitronectin receptor).

Interacts with SH3GL2 and SNX9; this interaction occurs preferentially with ADAM15 precursor, rather than the processed form, suggesting it occurs in a secretory pathway compartment prior to the medial Golgi.

Interacts with ITAG9-ITGB1 (By similarity).

Interacts specifically with Src family protein-tyrosine kinases (PTKs).

Interacts with SH3PXD2A.

Interacts with ITAGV-ITGB1.

Interacts with GRB2, HCK, ITSN1, ITSN2, LYN, MAPK1, MAPK3, NCF1, NCK1, nephrocystin, PTK6, SNX33, LCK and SRC.

By similarity7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114287, 35 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q13444

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q13444

Protein interaction database and analysis system

More...
IntActi
Q13444, 39 interactors

Molecular INTeraction database

More...
MINTi
Q13444

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000349436

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13444

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini213 – 414Peptidase M12BPROSITE-ProRule annotationAdd BLAST202
Domaini421 – 508DisintegrinPROSITE-ProRule annotationAdd BLAST88
Domaini657 – 685EGF-likePROSITE-ProRule annotationAdd BLAST29

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi177 – 184Cysteine switchBy similarity8
Motifi484 – 486Cell attachment sitePROSITE-ProRule annotation3
Motifi815 – 821SH3-bindingSequence analysis7
Motifi850 – 856SH3-bindingSequence analysis7

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi509 – 656Cys-richAdd BLAST148

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The cytoplasmic domain is required for SH3GL2- and SNX9-binding.
Disintegrin domain binds to integrin alphaV-beta3.
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Keywords - Domaini

EGF-like domain, SH3-binding, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3607 Eukaryota
ENOG410XX2M LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159822

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230884

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13444

KEGG Orthology (KO)

More...
KOi
K06836

Identification of Orthologs from Complete Genome Data

More...
OMAi
WEMLEAN

Database of Orthologous Groups

More...
OrthoDBi
162519at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13444

TreeFam database of animal gene trees

More...
TreeFami
TF314733

Family and domain databases

Conserved Domains Database

More...
CDDi
cd04269 ZnMc_adamalysin_II_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.390.10, 1 hit
4.10.70.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033605 ADAM15
IPR006586 ADAM_Cys-rich
IPR001762 Disintegrin_dom
IPR036436 Disintegrin_dom_sf
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR024079 MetalloPept_cat_dom_sf
IPR001590 Peptidase_M12B
IPR002870 Peptidase_M12B_N
IPR034027 Reprolysin_adamalysin

The PANTHER Classification System

More...
PANTHERi
PTHR11905:SF130 PTHR11905:SF130, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08516 ADAM_CR, 1 hit
PF00200 Disintegrin, 1 hit
PF01562 Pep_M12B_propep, 1 hit
PF01421 Reprolysin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00608 ACR, 1 hit
SM00050 DISIN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57552 SSF57552, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50215 ADAM_MEPRO, 1 hit
PS50214 DISINTEGRIN_2, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS00142 ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (13)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 13 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q13444-1) [UniParc]FASTAAdd to basket
Also known as: 6b

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRLALLWALG LLGAGSPLPS WPLPNIGGTE EQQAESEKAP REPLEPQVLQ
60 70 80 90 100
DDLPISLKKV LQTSLPEPLR IKLELDGDSH ILELLQNREL VPGRPTLVWY
110 120 130 140 150
QPDGTRVVSE GHTLENCCYQ GRVRGYAGSW VSICTCSGLR GLVVLTPERS
160 170 180 190 200
YTLEQGPGDL QGPPIISRIQ DLHLPGHTCA LSWRESVHTQ KPPEHPLGQR
210 220 230 240 250
HIRRRRDVVT ETKTVELVIV ADHSEAQKYR DFQHLLNRTL EVALLLDTFF
260 270 280 290 300
RPLNVRVALV GLEAWTQRDL VEISPNPAVT LENFLHWRRA HLLPRLPHDS
310 320 330 340 350
AQLVTGTSFS GPTVGMAIQN SICSPDFSGG VNMDHSTSIL GVASSIAHEL
360 370 380 390 400
GHSLGLDHDL PGNSCPCPGP APAKTCIMEA STDFLPGLNF SNCSRRALEK
410 420 430 440 450
ALLDGMGSCL FERLPSLPPM AAFCGNMFVE PGEQCDCGFL DDCVDPCCDS
460 470 480 490 500
LTCQLRPGAQ CASDGPCCQN CQLRPSGWQC RPTRGDCDLP EFCPGDSSQC
510 520 530 540 550
PPDVSLGDGE PCAGGQAVCM HGRCASYAQQ CQSLWGPGAQ PAAPLCLQTA
560 570 580 590 600
NTRGNAFGSC GRNPSGSYVS CTPRDAICGQ LQCQTGRTQP LLGSIRDLLW
610 620 630 640 650
ETIDVNGTEL NCSWVHLDLG SDVAQPLLTL PGTACGPGLV CIDHRCQRVD
660 670 680 690 700
LLGAQECRSK CHGHGVCDSN RHCYCEEGWA PPDCTTQLKA TSSLTTGLLL
710 720 730 740 750
SLLVLLVLVM LGASYWYRAR LHQRLCQLKG PTCQYRAAQS GPSERPGPPQ
760 770 780 790 800
RALLARGTKQ ASALSFPAPP SRPLPPDPVS KRLQAELADR PNPPTRPLPA
810 820 830 840 850
DPVVRSPKSQ GPAKPPPPRK PLPADPQGRC PSGDLPGPGA GIPPLVVPSR
860
PAPPPPTVSS LYL
Length:863
Mass (Da):92,959
Last modified:July 13, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i004936E9182629CA
GO
Isoform 2 (identifier: Q13444-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     760-808: Missing.

Show »
Length:814
Mass (Da):87,744
Checksum:iC6A297D51BED277E
GO
Isoform 3 (identifier: Q13444-3) [UniParc]FASTAAdd to basket
Also known as: 6a

The sequence of this isoform differs from the canonical sequence as follows:
     760-760: Missing.

Show »
Length:862
Mass (Da):92,831
Checksum:iC39147754DD6B63C
GO
Isoform 4 (identifier: Q13444-4) [UniParc]FASTAAdd to basket
Also known as: 4a

The sequence of this isoform differs from the canonical sequence as follows:
     785-808: Missing.

Show »
Length:839
Mass (Da):90,383
Checksum:i3B5F7590EFE0EBC1
GO
Isoform 5 (identifier: Q13444-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     760-784: Missing.

Show »
Length:838
Mass (Da):90,320
Checksum:i22637515284E16E8
GO
Isoform 6 (identifier: Q13444-6) [UniParc]FASTAAdd to basket
Also known as: 7b

The sequence of this isoform differs from the canonical sequence as follows:
     809-863: SQGPAKPPPPRKPLPADPQGRCPSGDLPGPGAGIPPLVVPSRPAPPPPTVSSLYL → VTVGGEKGTASPPT

Show »
Length:822
Mass (Da):88,779
Checksum:i2C01760368BEAF58
GO
Isoform 7 (identifier: Q13444-7) [UniParc]FASTAAdd to basket
Also known as: 7a

The sequence of this isoform differs from the canonical sequence as follows:
     760-760: Missing.
     809-863: SQGPAKPPPPRKPLPADPQGRCPSGDLPGPGAGIPPLVVPSRPAPPPPTVSSLYL → VTVGGEKGTASPPT

Show »
Length:821
Mass (Da):88,651
Checksum:i574AC60AD10ACFCE
GO
Isoform 8 (identifier: Q13444-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     760-784: Missing.
     809-863: SQGPAKPPPPRKPLPADPQGRCPSGDLPGPGAGIPPLVVPSRPAPPPPTVSSLYL → VTVGGEKGTASPPT

Show »
Length:797
Mass (Da):86,140
Checksum:i402644A60C8BB7A3
GO
Isoform 9 (identifier: Q13444-9) [UniParc]FASTAAdd to basket
Also known as: 3a

The sequence of this isoform differs from the canonical sequence as follows:
     737-796: AAQSGPSERP...LADRPNPPTR → LVLSASRPPL...CPAQGLESRP
     797-863: Missing.

Show »
Length:796
Mass (Da):86,311
Checksum:i7C808DCF0D1C296A
GO
Isoform 10 (identifier: Q13444-10) [UniParc]FASTAAdd to basket
Also known as: 1

The sequence of this isoform differs from the canonical sequence as follows:
     736-772: RAAQSGPSERPGPPQRALLARGTKQASALSFPAPPSR → SLRGQPSPHPQGSHCLPTPRAGAHRVTCPAQGLESRP
     773-863: Missing.

Show »
Length:772
Mass (Da):83,664
Checksum:i3EE4998C8EDCF958
GO
Isoform 11 (identifier: Q13444-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     94-387: Missing.
     760-808: Missing.

Show »
Length:520
Mass (Da):55,446
Checksum:i601F3874454899A0
GO
Isoform 12 (identifier: Q13444-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     26-26: I → IVLSWGVLGPA
     760-808: Missing.

Note: No experimental confirmation available.
Show »
Length:824
Mass (Da):88,724
Checksum:i84B3BF611CBF9E9D
GO
Isoform 13 (identifier: Q13444-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-87: GGTEEQQAES...DSHILELLQN → VSACNVEAPQ...ISQLASKRCF
     641-649: CIDHRCQRV → SSLGGQDQV
     650-863: Missing.

Note: No experimental confirmation available.
Show »
Length:633
Mass (Da):68,256
Checksum:i6C412A20B4E83369
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti81I → V in BAG52157 (PubMed:16303743).Curated1
Sequence conflicti104G → C in BAG59890 (PubMed:14702039).Curated1
Sequence conflicti191K → T in BAG59890 (PubMed:14702039).Curated1
Sequence conflicti286H → Y in BAG59477 (PubMed:14702039).Curated1
Sequence conflicti649V → A in BAG52157 (PubMed:16303743).Curated1
Sequence conflicti714S → G in AAC50404 (PubMed:9039960).Curated1
Sequence conflicti840A → P in AAC51112 (PubMed:8617717).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_060315191K → T7 PublicationsCorresponds to variant dbSNP:rs6427128Ensembl.1
Natural variantiVAR_068970216E → K1 PublicationCorresponds to variant dbSNP:rs115753757Ensembl.1
Natural variantiVAR_060316294P → H. Corresponds to variant dbSNP:rs2306122Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04469526I → IVLSWGVLGPA in isoform 12. 1 Publication1
Alternative sequenceiVSP_05514327 – 87GGTEE…ELLQN → VSACNVEAPQVALRSSRQSQ RRPRGSPWSPRSFRTISQLA SKRCF in isoform 13. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_03952494 – 387Missing in isoform 11. 1 PublicationAdd BLAST294
Alternative sequenceiVSP_055144641 – 649CIDHRCQRV → SSLGGQDQV in isoform 13. 1 Publication9
Alternative sequenceiVSP_055145650 – 863Missing in isoform 13. 1 PublicationAdd BLAST214
Alternative sequenceiVSP_039525736 – 772RAAQS…APPSR → SLRGQPSPHPQGSHCLPTPR AGAHRVTCPAQGLESRP in isoform 10. 3 PublicationsAdd BLAST37
Alternative sequenceiVSP_039526737 – 796AAQSG…NPPTR → LVLSASRPPLPGRCRLTLCP RDSSLRGQPSPHPQGSHCLP TPRAGAHRVTCPAQGLESRP in isoform 9. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_039527760 – 808Missing in isoform 2, isoform 11 and isoform 12. 8 PublicationsAdd BLAST49
Alternative sequenceiVSP_039528760 – 784Missing in isoform 5 and isoform 8. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_039529760Missing in isoform 3 and isoform 7. 1 Publication1
Alternative sequenceiVSP_039530773 – 863Missing in isoform 10. 3 PublicationsAdd BLAST91
Alternative sequenceiVSP_039531785 – 808Missing in isoform 4. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_039532797 – 863Missing in isoform 9. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_039533809 – 863SQGPA…SSLYL → VTVGGEKGTASPPT in isoform 6, isoform 7 and isoform 8. 1 PublicationAdd BLAST55

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U41767 mRNA Translation: AAC50404.1
U46005 mRNA Translation: AAC51112.1
AY518542 mRNA Translation: AAR99331.1
AF314227 Genomic DNA Translation: AAM44189.1
AF314227 Genomic DNA Translation: AAS48590.1
AF314227 Genomic DNA Translation: AAS48591.1
AF314227 Genomic DNA Translation: AAS48592.1
AF314227 Genomic DNA Translation: AAS48593.1
AF314227 Genomic DNA Translation: AAS48594.1
AF314227 Genomic DNA Translation: AAS48595.1
AF314227 Genomic DNA Translation: AAS48596.1
AF314227 Genomic DNA Translation: AAS48597.1
AF314227 Genomic DNA Translation: AAS72298.1
AY560593 mRNA Translation: AAS72991.1
AY560594 mRNA Translation: AAS72992.1
AY560595 mRNA Translation: AAS72993.1
AY560596 mRNA Translation: AAS72994.1
AY560597 mRNA Translation: AAS72995.1
AY560598 mRNA Translation: AAS72996.1
AY560599 mRNA Translation: AAS72997.1
AY560600 mRNA Translation: AAS72998.1
AY560601 mRNA Translation: AAS72999.1
AY576417 mRNA Translation: AAS73000.1
BT009764 mRNA Translation: AAP88766.1
AK296925 mRNA Translation: BAG59477.1
AK297468 mRNA Translation: BAG59890.1
AK075498 mRNA Translation: BAG52157.1
AL451085 Genomic DNA No translation available.
AL691442 Genomic DNA No translation available.
BC014566 mRNA Translation: AAH14566.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1084.1 [Q13444-2]
CCDS1085.1 [Q13444-4]
CCDS1086.1 [Q13444-5]
CCDS1087.1 [Q13444-1]
CCDS1088.1 [Q13444-10]
CCDS44236.1 [Q13444-3]
CCDS58031.1 [Q13444-12]
CCDS58032.1 [Q13444-9]
CCDS60282.1 [Q13444-13]

Protein sequence database of the Protein Information Resource

More...
PIRi
G02390

NCBI Reference Sequences

More...
RefSeqi
NP_001248393.1, NM_001261464.1 [Q13444-12]
NP_001248394.1, NM_001261465.1 [Q13444-9]
NP_001248395.1, NM_001261466.1 [Q13444-13]
NP_003806.3, NM_003815.4 [Q13444-2]
NP_997074.1, NM_207191.2 [Q13444-10]
NP_997077.1, NM_207194.2 [Q13444-4]
NP_997078.1, NM_207195.2 [Q13444-5]
NP_997079.1, NM_207196.2 [Q13444-3]
NP_997080.1, NM_207197.2 [Q13444-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000271836; ENSP00000271836; ENSG00000143537 [Q13444-2]
ENST00000355956; ENSP00000348227; ENSG00000143537 [Q13444-4]
ENST00000356955; ENSP00000349436; ENSG00000143537 [Q13444-1]
ENST00000359280; ENSP00000352226; ENSG00000143537 [Q13444-5]
ENST00000360674; ENSP00000353892; ENSG00000143537 [Q13444-10]
ENST00000368412; ENSP00000357397; ENSG00000143537 [Q13444-9]
ENST00000368413; ENSP00000357398; ENSG00000143537 [Q13444-11]
ENST00000447332; ENSP00000476000; ENSG00000143537 [Q13444-13]
ENST00000449910; ENSP00000403843; ENSG00000143537 [Q13444-3]
ENST00000526491; ENSP00000432347; ENSG00000143537 [Q13444-6]
ENST00000529473; ENSP00000434227; ENSG00000143537 [Q13444-8]
ENST00000531455; ENSP00000432927; ENSG00000143537 [Q13444-12]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8751

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8751

UCSC genome browser

More...
UCSCi
uc001fgr.3 human [Q13444-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U41767 mRNA Translation: AAC50404.1
U46005 mRNA Translation: AAC51112.1
AY518542 mRNA Translation: AAR99331.1
AF314227 Genomic DNA Translation: AAM44189.1
AF314227 Genomic DNA Translation: AAS48590.1
AF314227 Genomic DNA Translation: AAS48591.1
AF314227 Genomic DNA Translation: AAS48592.1
AF314227 Genomic DNA Translation: AAS48593.1
AF314227 Genomic DNA Translation: AAS48594.1
AF314227 Genomic DNA Translation: AAS48595.1
AF314227 Genomic DNA Translation: AAS48596.1
AF314227 Genomic DNA Translation: AAS48597.1
AF314227 Genomic DNA Translation: AAS72298.1
AY560593 mRNA Translation: AAS72991.1
AY560594 mRNA Translation: AAS72992.1
AY560595 mRNA Translation: AAS72993.1
AY560596 mRNA Translation: AAS72994.1
AY560597 mRNA Translation: AAS72995.1
AY560598 mRNA Translation: AAS72996.1
AY560599 mRNA Translation: AAS72997.1
AY560600 mRNA Translation: AAS72998.1
AY560601 mRNA Translation: AAS72999.1
AY576417 mRNA Translation: AAS73000.1
BT009764 mRNA Translation: AAP88766.1
AK296925 mRNA Translation: BAG59477.1
AK297468 mRNA Translation: BAG59890.1
AK075498 mRNA Translation: BAG52157.1
AL451085 Genomic DNA No translation available.
AL691442 Genomic DNA No translation available.
BC014566 mRNA Translation: AAH14566.1
CCDSiCCDS1084.1 [Q13444-2]
CCDS1085.1 [Q13444-4]
CCDS1086.1 [Q13444-5]
CCDS1087.1 [Q13444-1]
CCDS1088.1 [Q13444-10]
CCDS44236.1 [Q13444-3]
CCDS58031.1 [Q13444-12]
CCDS58032.1 [Q13444-9]
CCDS60282.1 [Q13444-13]
PIRiG02390
RefSeqiNP_001248393.1, NM_001261464.1 [Q13444-12]
NP_001248394.1, NM_001261465.1 [Q13444-9]
NP_001248395.1, NM_001261466.1 [Q13444-13]
NP_003806.3, NM_003815.4 [Q13444-2]
NP_997074.1, NM_207191.2 [Q13444-10]
NP_997077.1, NM_207194.2 [Q13444-4]
NP_997078.1, NM_207195.2 [Q13444-5]
NP_997079.1, NM_207196.2 [Q13444-3]
NP_997080.1, NM_207197.2 [Q13444-1]

3D structure databases

SMRiQ13444
ModBaseiSearch...

Protein-protein interaction databases

BioGridi114287, 35 interactors
CORUMiQ13444
ELMiQ13444
IntActiQ13444, 39 interactors
MINTiQ13444
STRINGi9606.ENSP00000349436

Chemistry databases

ChEMBLiCHEMBL2331050

Protein family/group databases

MEROPSiM12.215

PTM databases

GlyConnecti1179
iPTMnetiQ13444
PhosphoSitePlusiQ13444

Polymorphism and mutation databases

BioMutaiADAM15
DMDMi300669614

Proteomic databases

EPDiQ13444
jPOSTiQ13444
MaxQBiQ13444
PaxDbiQ13444
PeptideAtlasiQ13444
PRIDEiQ13444
ProteomicsDBi22321
59442 [Q13444-1]
59443 [Q13444-10]
59444 [Q13444-11]
59445 [Q13444-2]
59446 [Q13444-3]
59447 [Q13444-4]
59448 [Q13444-5]
59449 [Q13444-6]
59450 [Q13444-7]
59451 [Q13444-8]
59452 [Q13444-9]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q13444

The DNASU plasmid repository

More...
DNASUi
8751
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000271836; ENSP00000271836; ENSG00000143537 [Q13444-2]
ENST00000355956; ENSP00000348227; ENSG00000143537 [Q13444-4]
ENST00000356955; ENSP00000349436; ENSG00000143537 [Q13444-1]
ENST00000359280; ENSP00000352226; ENSG00000143537 [Q13444-5]
ENST00000360674; ENSP00000353892; ENSG00000143537 [Q13444-10]
ENST00000368412; ENSP00000357397; ENSG00000143537 [Q13444-9]
ENST00000368413; ENSP00000357398; ENSG00000143537 [Q13444-11]
ENST00000447332; ENSP00000476000; ENSG00000143537 [Q13444-13]
ENST00000449910; ENSP00000403843; ENSG00000143537 [Q13444-3]
ENST00000526491; ENSP00000432347; ENSG00000143537 [Q13444-6]
ENST00000529473; ENSP00000434227; ENSG00000143537 [Q13444-8]
ENST00000531455; ENSP00000432927; ENSG00000143537 [Q13444-12]
GeneIDi8751
KEGGihsa:8751
UCSCiuc001fgr.3 human [Q13444-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8751
DisGeNETi8751

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ADAM15
HGNCiHGNC:193 ADAM15
HPAiHPA011633
HPA072878
MIMi605548 gene
neXtProtiNX_Q13444
OpenTargetsiENSG00000143537
PharmGKBiPA24510

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3607 Eukaryota
ENOG410XX2M LUCA
GeneTreeiENSGT00940000159822
HOGENOMiHOG000230884
InParanoidiQ13444
KOiK06836
OMAiWEMLEAN
OrthoDBi162519at2759
PhylomeDBiQ13444
TreeFamiTF314733

Enzyme and pathway databases

ReactomeiR-HSA-1474228 Degradation of the extracellular matrix
R-HSA-8941237 Invadopodia formation
SIGNORiQ13444

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ADAM15

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8751

Protein Ontology

More...
PROi
PR:Q13444

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143537 Expressed in 144 organ(s), highest expression level in left lobe of thyroid gland
GenevisibleiQ13444 HS

Family and domain databases

CDDicd04269 ZnMc_adamalysin_II_like, 1 hit
Gene3Di3.40.390.10, 1 hit
4.10.70.10, 1 hit
InterProiView protein in InterPro
IPR033605 ADAM15
IPR006586 ADAM_Cys-rich
IPR001762 Disintegrin_dom
IPR036436 Disintegrin_dom_sf
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR024079 MetalloPept_cat_dom_sf
IPR001590 Peptidase_M12B
IPR002870 Peptidase_M12B_N
IPR034027 Reprolysin_adamalysin
PANTHERiPTHR11905:SF130 PTHR11905:SF130, 1 hit
PfamiView protein in Pfam
PF08516 ADAM_CR, 1 hit
PF00200 Disintegrin, 1 hit
PF01562 Pep_M12B_propep, 1 hit
PF01421 Reprolysin, 1 hit
SMARTiView protein in SMART
SM00608 ACR, 1 hit
SM00050 DISIN, 1 hit
SUPFAMiSSF57552 SSF57552, 1 hit
PROSITEiView protein in PROSITE
PS50215 ADAM_MEPRO, 1 hit
PS50214 DISINTEGRIN_2, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS00142 ZINC_PROTEASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADA15_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13444
Secondary accession number(s): B3KQU5
, B4DLB5, B4DMH8, E9PN65, Q13493, Q53XQ0, Q5SR68, Q5SR69, Q6R267, Q71S61, Q71S62, Q71S63, Q71S64, Q71S65, Q71S66, Q71S67, Q71S68, Q71S69, Q96C78, U3KQL5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: July 13, 2010
Last modified: July 31, 2019
This is version 205 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again