Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (31 Jul 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

DAZ-associated protein 2

Gene

DAZAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q15038 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DAZ-associated protein 2
Alternative name(s):
Deleted in azoospermia-associated protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DAZAP2
Synonyms:KIAA0058
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2684 DAZAP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607431 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15038

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9802

Open Targets

More...
OpenTargetsi
ENSG00000183283

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27154

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DAZAP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
44887865

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000797881 – 168DAZ-associated protein 2Add BLAST168

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by SMURF2, leading to proteasomal degradation.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15038

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15038

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15038

PeptideAtlas

More...
PeptideAtlasi
Q15038

PRoteomics IDEntifications database

More...
PRIDEi
Q15038

ProteomicsDB human proteome resource

More...
ProteomicsDBi
11080
19140
28699
60386 [Q15038-1]
60387 [Q15038-2]
9296

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15038

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15038

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Down-regulated in multiple myeloma.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000183283 Expressed in 233 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15038 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15038 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045940

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SOX6 (By similarity).

Interacts with DAZ and DAZL.

Interacts with IL17RB. May interact with FAM168B.

Interacts with INCA1 (PubMed:21750715).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
itself4EBI-724310,EBI-724310
ARID5AQ039896EBI-724310,EBI-948603
ATXN1P542532EBI-724310,EBI-930964
BAG3O958176EBI-724310,EBI-747185
BATF2Q8N1L93EBI-724310,EBI-742695
C1orf94Q6P1W56EBI-724310,EBI-946029
CALCOCO2Q131374EBI-724310,EBI-739580
DAB1O755533EBI-724310,EBI-7875264
DCUN1D1Q96GG96EBI-724310,EBI-740086
EPN1Q9Y6I33EBI-724310,EBI-713198
EXD3Q8N9H83EBI-724310,EBI-750745
FAM168AQ925673EBI-724310,EBI-7957930
HGSO149646EBI-724310,EBI-740220
HIP1O002913EBI-724310,EBI-473886
INCA1Q0VD862EBI-724310,EBI-6509505
KRTAP19-5Q3LI727EBI-724310,EBI-1048945
KRTAP6-1Q3LI644EBI-724310,EBI-12111050
KRTAP8-1Q8IUC25EBI-724310,EBI-10261141
MAGED1Q9Y5V33EBI-724310,EBI-716006
MTURNQ8N3F04EBI-724310,EBI-11980301
NEDD4LQ96PU53EBI-724310,EBI-717962
OPTNQ96CV95EBI-724310,EBI-748974
OTULINQ96BN85EBI-724310,EBI-750730
PEF1Q9UBV85EBI-724310,EBI-724639
PLEKHB2Q96CS77EBI-724310,EBI-373552
PLSCR1O151624EBI-724310,EBI-740019
POGZQ7Z3K35EBI-724310,EBI-1389308
POLIQ9UNA43EBI-724310,EBI-741774
PRR20CP864794EBI-724310,EBI-10172814
RABGEF1Q9UJ413EBI-724310,EBI-913954
RBFOX1Q9NWB1-53EBI-724310,EBI-12123390
RBFOX2O432514EBI-724310,EBI-746056
RBPMSQ930626EBI-724310,EBI-740322
RBPMSQ93062-36EBI-724310,EBI-740343
RHOXF2Q9BQY412EBI-724310,EBI-372094
RNF115Q9Y4L54EBI-724310,EBI-2129242
RNF208Q9H0X68EBI-724310,EBI-751555
ROR2A1L4F53EBI-724310,EBI-10172778
RPS27AP629798EBI-724310,EBI-357375
SMAP2Q8WU795EBI-724310,EBI-2822515
SQSTM1Q135013EBI-724310,EBI-307104
STAM2O758866EBI-724310,EBI-373258
TAX1BP1Q86VP15EBI-724310,EBI-529518
TENT5BQ96A094EBI-724310,EBI-752030
TEX37Q96LM65EBI-724310,EBI-743976
TNIP3Q96KP67EBI-724310,EBI-2509913
TOLLIPQ6FIE93EBI-724310,EBI-10249783
TOLLIPQ9H0E28EBI-724310,EBI-74615
UBA52P629875EBI-724310,EBI-357304
UBAC1Q9BSL16EBI-724310,EBI-749370
UBASH3AP570754EBI-724310,EBI-2105393
UBASH3BQ8TF425EBI-724310,EBI-1380492
UBBP0CG476EBI-724310,EBI-413034
UBBQ5U5U63EBI-724310,EBI-1642104
UBCP0CG484EBI-724310,EBI-3390054
UBCQ96C324EBI-724310,EBI-745483
UBE2D4Q9Y2X83EBI-724310,EBI-745527
UBE2E2Q96LR53EBI-724310,EBI-2129763
UBQLN2Q9UHD94EBI-724310,EBI-947187
USP5P459743EBI-724310,EBI-741277
VHLLQ6RSH75EBI-724310,EBI-10254232
VPS37CA5D8V65EBI-724310,EBI-2559305
WWOXQ9NZC7-54EBI-724310,EBI-12040603
ZC3H10Q96K804EBI-724310,EBI-742550
ZFAND2BQ8WV998EBI-724310,EBI-747823

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115143, 106 interactors

Protein interaction database and analysis system

More...
IntActi
Q15038, 173 interactors

Molecular INTeraction database

More...
MINTi
Q15038

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000448051

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15038

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi8 – 134Pro-richAdd BLAST127

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVQC Eukaryota
ENOG4111N7I LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000685

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007683

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15038

Identification of Orthologs from Complete Genome Data

More...
OMAi
PTIMVPN

Database of Orthologous Groups

More...
OrthoDBi
1175298at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15038

TreeFam database of animal gene trees

More...
TreeFami
TF329672

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022730 DAZ_assoc-2

The PANTHER Classification System

More...
PANTHERi
PTHR31638 PTHR31638, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11029 DAZAP2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15038-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNSKGQYPTQ PTYPVQPPGN PVYPQTLHLP QAPPYTDAPP AYSELYRPSF
60 70 80 90 100
VHPGAATVPT MSAAFPGASL YLPMAQSVAV GPLGSTIPMA YYPVGPIYPP
110 120 130 140 150
GSTVLVEGGY DAGARFGAGA TAGNIPPPPP GCPPNAAQLA VMQGANVLVT
160
QRKGNFFMGG SDGGYTIW
Length:168
Mass (Da):17,319
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i49F1B6D281E24AAC
GO
Isoform 2 (identifier: Q15038-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-168: PPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW → VKEDQDHDREQGEEDNGDNNLERRGKM

Note: No experimental confirmation available.
Show »
Length:153
Mass (Da):16,187
Checksum:iFAF1904AF43CA4E4
GO
Isoform 6 (identifier: Q15038-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     65-86: Missing.

Note: No experimental confirmation available.
Show »
Length:146
Mass (Da):15,173
Checksum:i3EA0DB83FB16A1A8
GO
Isoform 3 (identifier: Q15038-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-76: Missing.

Show »
Length:136
Mass (Da):13,987
Checksum:i46E379CE7F8A3A04
GO
Isoform 4 (identifier: Q15038-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-126: Missing.

Note: No experimental confirmation available.
Show »
Length:86
Mass (Da):9,167
Checksum:i5A99269B0CBA9174
GO
Isoform 5 (identifier: Q15038-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-168: GSTVLVEGGY...GGSDGGYTIW → ASTSWMPSQC...RNHVMVAVPP

Note: No experimental confirmation available.
Show »
Length:207
Mass (Da):22,823
Checksum:i24B6E3CC46C33150
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R3Q0S4R3Q0_HUMAN
DAZ-associated protein 2
DAZAP2
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VUW5F8VUW5_HUMAN
DAZ-associated protein 2
DAZAP2
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PE89E9PE89_HUMAN
DAZ-associated protein 2
DAZAP2
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA06545 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29L → P in BAG64775 (PubMed:14702039).Curated1
Sequence conflicti47R → S in AAR11454 (PubMed:17935665).Curated1
Sequence conflicti90A → V in BU662353 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061639102S → A. Corresponds to variant dbSNP:rs57917280Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04567845 – 126Missing in isoform 4. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_04567945 – 76Missing in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_05518165 – 86Missing in isoform 6. CuratedAdd BLAST22
Alternative sequenceiVSP_046764101 – 168GSTVL…GYTIW → ASTSWMPSQCCSACSHAGSQ RPRNSAEGELLHGWFRWWLH HLVRNQGHLCAGKDITYLQH FSQCNCFSHINLKLQFRHML LGCLSGAQTFRHFSNLIRNH VMVAVPP in isoform 5. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_042773127 – 168PPPPG…GYTIW → VKEDQDHDREQGEEDNGDNN LERRGKM in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY430097 mRNA Translation: AAR11454.1
BU662353 mRNA No translation available.
D31767 mRNA Translation: BAA06545.2 Different initiation.
BX441137 mRNA No translation available.
AK095963 mRNA No translation available.
AK290119 mRNA Translation: BAF82808.1
AK293330 mRNA Translation: BAG56846.1
AK303828 mRNA Translation: BAG64775.1
AC046135 Genomic DNA No translation available.
AC139768 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58181.1
BC002334 mRNA Translation: AAH02334.1
BC007900 mRNA Translation: AAH07900.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44884.1 [Q15038-2]
CCDS44885.1 [Q15038-5]
CCDS44886.1 [Q15038-6]
CCDS44887.1 [Q15038-3]
CCDS44888.1 [Q15038-4]
CCDS8809.1 [Q15038-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129736.1, NM_001136264.1 [Q15038-6]
NP_001129738.1, NM_001136266.1 [Q15038-5]
NP_001129739.1, NM_001136267.1 [Q15038-3]
NP_001129740.1, NM_001136268.1 [Q15038-4]
NP_001129741.1, NM_001136269.1 [Q15038-2]
NP_055579.1, NM_014764.3 [Q15038-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000412716; ENSP00000394699; ENSG00000183283 [Q15038-1]
ENST00000425012; ENSP00000408251; ENSG00000183283 [Q15038-2]
ENST00000439799; ENSP00000398804; ENSG00000183283 [Q15038-4]
ENST00000449723; ENSP00000412812; ENSG00000183283 [Q15038-6]
ENST00000549555; ENSP00000448051; ENSG00000183283 [Q15038-5]
ENST00000549732; ENSP00000446554; ENSG00000183283 [Q15038-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9802

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9802

UCSC genome browser

More...
UCSCi
uc001ryb.4 human [Q15038-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY430097 mRNA Translation: AAR11454.1
BU662353 mRNA No translation available.
D31767 mRNA Translation: BAA06545.2 Different initiation.
BX441137 mRNA No translation available.
AK095963 mRNA No translation available.
AK290119 mRNA Translation: BAF82808.1
AK293330 mRNA Translation: BAG56846.1
AK303828 mRNA Translation: BAG64775.1
AC046135 Genomic DNA No translation available.
AC139768 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58181.1
BC002334 mRNA Translation: AAH02334.1
BC007900 mRNA Translation: AAH07900.1
CCDSiCCDS44884.1 [Q15038-2]
CCDS44885.1 [Q15038-5]
CCDS44886.1 [Q15038-6]
CCDS44887.1 [Q15038-3]
CCDS44888.1 [Q15038-4]
CCDS8809.1 [Q15038-1]
RefSeqiNP_001129736.1, NM_001136264.1 [Q15038-6]
NP_001129738.1, NM_001136266.1 [Q15038-5]
NP_001129739.1, NM_001136267.1 [Q15038-3]
NP_001129740.1, NM_001136268.1 [Q15038-4]
NP_001129741.1, NM_001136269.1 [Q15038-2]
NP_055579.1, NM_014764.3 [Q15038-1]

3D structure databases

SMRiQ15038
ModBaseiSearch...

Protein-protein interaction databases

BioGridi115143, 106 interactors
IntActiQ15038, 173 interactors
MINTiQ15038
STRINGi9606.ENSP00000448051

Protein family/group databases

MoonDBiQ15038 Predicted

PTM databases

iPTMnetiQ15038
PhosphoSitePlusiQ15038

Polymorphism and mutation databases

BioMutaiDAZAP2
DMDMi44887865

Proteomic databases

jPOSTiQ15038
MaxQBiQ15038
PaxDbiQ15038
PeptideAtlasiQ15038
PRIDEiQ15038
ProteomicsDBi11080
19140
28699
60386 [Q15038-1]
60387 [Q15038-2]
9296

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9802
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000412716; ENSP00000394699; ENSG00000183283 [Q15038-1]
ENST00000425012; ENSP00000408251; ENSG00000183283 [Q15038-2]
ENST00000439799; ENSP00000398804; ENSG00000183283 [Q15038-4]
ENST00000449723; ENSP00000412812; ENSG00000183283 [Q15038-6]
ENST00000549555; ENSP00000448051; ENSG00000183283 [Q15038-5]
ENST00000549732; ENSP00000446554; ENSG00000183283 [Q15038-3]
GeneIDi9802
KEGGihsa:9802
UCSCiuc001ryb.4 human [Q15038-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9802
DisGeNETi9802

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DAZAP2
HGNCiHGNC:2684 DAZAP2
HPAiHPA045940
MIMi607431 gene
neXtProtiNX_Q15038
OpenTargetsiENSG00000183283
PharmGKBiPA27154

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVQC Eukaryota
ENOG4111N7I LUCA
GeneTreeiENSGT00390000000685
HOGENOMiHOG000007683
InParanoidiQ15038
OMAiPTIMVPN
OrthoDBi1175298at2759
PhylomeDBiQ15038
TreeFamiTF329672

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DAZAP2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DAZAP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9802

Protein Ontology

More...
PROi
PR:Q15038

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000183283 Expressed in 233 organ(s), highest expression level in blood
ExpressionAtlasiQ15038 baseline and differential
GenevisibleiQ15038 HS

Family and domain databases

InterProiView protein in InterPro
IPR022730 DAZ_assoc-2
PANTHERiPTHR31638 PTHR31638, 1 hit
PfamiView protein in Pfam
PF11029 DAZAP2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDAZP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15038
Secondary accession number(s): A8K254
, B4DDT5, B4E1G3, C9JA96, C9JP84, E9PB45, F8VU62
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: November 1, 1996
Last modified: July 31, 2019
This is version 154 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again