Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (16 Oct 2019)
Sequence version 2 (02 Nov 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Triokinase/FMN cyclase

Gene

TKFC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes both the phosphorylation of dihydroxyacetone and of glyceraldehyde, and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate. Represses IFIH1-mediated cellular antiviral response (PubMed:17600090).By similarity3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Each activity is inhibited by the substrate(s) of the other.

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.5 µM for dihydroxyacetone1 Publication
  2. KM=11 µM for glyceraldehyde1 Publication
  3. KM=1.55 µM for dihydroxyacetone1 Publication
  4. KM=43.2 µM for ATP1 Publication
  5. KM=18.1 µM for glyceraldehyde1 Publication
  6. KM=7 µM for FAD1 Publication
  7. KM=12 µM for ADP-glucose1 Publication
  8. KM=317 µM for UDP-glucose1 Publication
  9. KM=263 µM for UDP-galactose1 Publication

    pH dependencei

    Optimum pH is 6.6.1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei109DihydroxyacetonePROSITE-ProRule annotation1
    Binding sitei114DihydroxyacetonePROSITE-ProRule annotation1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei221Tele-hemiaminal-histidine intermediatePROSITE-ProRule annotation1
    Binding sitei486ATP; via carbonyl oxygenBy similarity1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi401 – 404ATPBy similarity4
    Nucleotide bindingi446 – 447ATPBy similarity2
    Nucleotide bindingi494 – 495ATPBy similarity2
    Nucleotide bindingi556 – 558ATPBy similarity3

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionKinase, Lyase, Multifunctional enzyme, Transferase
    LigandATP-binding, Cobalt, FAD, Flavoprotein, Magnesium, Manganese, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    2.7.1.29 2681
    4.6.1.15 2681

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-168928 DDX58/IFIH1-mediated induction of interferon-alpha/beta
    R-HSA-70350 Fructose catabolism

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Triokinase/FMN cyclaseImported
    Alternative name(s):
    Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
    Including the following 2 domains:
    ATP-dependent dihydroxyacetone kinase (EC:2.7.1.28, EC:2.7.1.29)
    Short name:
    DHA kinase
    Alternative name(s):
    Glycerone kinase
    Triokinase
    Triose kinase
    FAD-AMP lyase (cyclizing) (EC:4.6.1.15)
    Alternative name(s):
    FAD-AMP lyase (cyclic FMN forming)
    FMN cyclase
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:TKFCImported
    Synonyms:DAKImported
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:24552 TKFC

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    615844 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q3LXA3

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi112T → A: Highly decreases kinase activity. No effect on FMN cyclase activity. 1 Publication1
    Mutagenesisi204K → A: Slightly decreases kinase activity. No effect on FMN cyclase activity. 1 Publication1
    Mutagenesisi221H → A: Abolishes kinase activity but not FMN cyclase activity. 1 Publication1
    Mutagenesisi401D → A: Abolishes both kinase and FMN cyclase activities. 1 Publication1
    Mutagenesisi403D → A: Abolishes both kinase and FMN cyclase activities. 1 Publication1
    Mutagenesisi404C → A: Decreases both kinase and FMN cyclase activities. 1 Publication1
    Mutagenesisi446S → A: Decreases both kinase and FMN cyclase activities. 1 Publication1
    Mutagenesisi556D → A: Abolishes both kinase and FMN cyclase activities. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    26007

    Open Targets

    More...
    OpenTargetsi
    ENSG00000149476

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA142672014

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q3LXA3

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    TKFC

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    311033370

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001215251 – 575Triokinase/FMN cyclaseAdd BLAST575

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei350PhosphoserineCombined sources1
    Modified residuei511PhosphoserineCombined sources1
    Modified residuei545PhosphoserineBy similarity1

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    The CPTAC Assay portal

    More...
    CPTACi
    CPTAC-188
    CPTAC-189

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q3LXA3

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q3LXA3

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q3LXA3

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q3LXA3

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q3LXA3

    PeptideAtlas

    More...
    PeptideAtlasi
    Q3LXA3

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q3LXA3

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    61779 [Q3LXA3-1]

    2D gel databases

    REPRODUCTION-2DPAGE

    More...
    REPRODUCTION-2DPAGEi
    IPI00551024

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q3LXA3

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q3LXA3

    Miscellaneous databases

    CutDB - Proteolytic event database

    More...
    PMAP-CutDBi
    Q3LXA3

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Detected in erythrocytes (at protein level).1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000149476 Expressed in 165 organ(s), highest expression level in right adrenal gland

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q3LXA3 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q3LXA3 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA039486
    HPA048186

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homodimer (By similarity).

    Interacts with IFIH1 (via the CARD domains), the interaction is inhibited by viral infection (PubMed:17600090).

    By similarity1 Publication

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    117481, 28 interactors

    Database of interacting proteins

    More...
    DIPi
    DIP-60967N

    Protein interaction database and analysis system

    More...
    IntActi
    Q3LXA3, 8 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000378360

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q3LXA3

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini9 – 336DhaKPROSITE-ProRule annotationAdd BLAST328
    Domaini372 – 571DhaLPROSITE-ProRule annotationAdd BLAST200

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni56 – 59Dihydroxyacetone bindingBy similarity4

    <p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    DhaK and DhaL domains have differential roles, individually DhaK is inactive and DhaL displays cyclase but not kinase activity.1 Publication

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG2426 Eukaryota
    COG2376 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00390000015415

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000234158

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q3LXA3

    KEGG Orthology (KO)

    More...
    KOi
    K00863

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    TALNMNG

    Database of Orthologous Groups

    More...
    OrthoDBi
    472175at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q3LXA3

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF313821

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    1.25.40.340, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR012734 DhaK_ATP
    IPR004006 DhaK_dom
    IPR004007 DhaL_dom
    IPR036117 DhaL_dom_sf

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF02733 Dak1, 1 hit
    PF02734 Dak2, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM01120 Dak2, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF101473 SSF101473, 1 hit

    TIGRFAMs; a protein family database

    More...
    TIGRFAMsi
    TIGR02361 dak_ATP, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS51481 DHAK, 1 hit
    PS51480 DHAL, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q3LXA3-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MTSKKLVNSV AGCADDALAG LVACNPNLQL LQGHRVALRS DLDSLKGRVA
    60 70 80 90 100
    LLSGGGSGHE PAHAGFIGKG MLTGVIAGAV FTSPAVGSIL AAIRAVAQAG
    110 120 130 140 150
    TVGTLLIVKN YTGDRLNFGL AREQARAEGI PVEMVVIGDD SAFTVLKKAG
    160 170 180 190 200
    RRGLCGTVLI HKVAGALAEA GVGLEEIAKQ VNVVAKAMGT LGVSLSSCSV
    210 220 230 240 250
    PGSKPTFELS ADEVELGLGI HGEAGVRRIK MATADEIVKL MLDHMTNTTN
    260 270 280 290 300
    ASHVPVQPGS SVVMMVNNLG GLSFLELGII ADATVRSLEG RGVKIARALV
    310 320 330 340 350
    GTFMSALEMP GISLTLLLVD EPLLKLIDAE TTAAAWPNVA AVSITGRKRS
    360 370 380 390 400
    RVAPAEPQEA PDSTAAGGSA SKRMALVLER VCSTLLGLEE HLNALDRAAG
    410 420 430 440 450
    DGDCGTTHSR AARAIQEWLK EGPPPASPAQ LLSKLSVLLL EKMGGSSGAL
    460 470 480 490 500
    YGLFLTAAAQ PLKAKTSLPA WSAAMDAGLE AMQKYGKAAP GDRTMLDSLW
    510 520 530 540 550
    AAGQELQAWK SPGADLLQVL TKAVKSAEAA AEATKNMEAG AGRASYISSA
    560 570
    RLEQPDPGAV AAAAILRAIL EVLQS
    Length:575
    Mass (Da):58,947
    Last modified:November 2, 2010 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4DB8C5326F65122C
    GO
    Isoform 2 (identifier: Q3LXA3-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         526-575: SAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAILEVLQS → EGGGLVICP

    Note: Inactive as DHA kinase and FMN cyclase.
    Show »
    Length:534
    Mass (Da):54,793
    Checksum:i6BC7E1EA00D32EC4
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    H0YCY6H0YCY6_HUMAN
    Triokinase/FMN cyclase
    TKFC
    533Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    I3L252I3L252_HUMAN
    Triokinase/FMN cyclase
    TKFC
    219Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    E9PJG8E9PJG8_HUMAN
    Triokinase/FMN cyclase
    TKFC
    162Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    E9PQR1E9PQR1_HUMAN
    Triokinase/FMN cyclase
    TKFC
    57Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti7V → A in BAB14722 (PubMed:14702039).Curated1
    Sequence conflicti19A → S in BAD97300 (Ref. 4) Curated1
    Sequence conflicti75V → A in BAB14722 (PubMed:14702039).Curated1
    Sequence conflicti376L → P in BAB14722 (PubMed:14702039).Curated1
    Sequence conflicti497D → G in BAB14722 (PubMed:14702039).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_028108185A → T4 PublicationsCorresponds to variant dbSNP:rs2260655Ensembl.1
    Natural variantiVAR_054780334A → G. Corresponds to variant dbSNP:rs35723406Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_057181526 – 575SAEAA…EVLQS → EGGGLVICP in isoform 2. 1 PublicationAdd BLAST50

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    DQ138290 mRNA Translation: ABA10576.1
    DQ344550 mRNA Translation: ABC70184.1
    AK023915 mRNA Translation: BAB14722.1
    AK223580 mRNA Translation: BAD97300.1
    AP003108 Genomic DNA No translation available.
    BC001341 mRNA Translation: AAH01341.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS8003.1 [Q3LXA3-1]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_056348.2, NM_015533.3 [Q3LXA3-1]
    XP_016873010.1, XM_017017521.1
    XP_016873012.1, XM_017017523.1

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000394900; ENSP00000378360; ENSG00000149476 [Q3LXA3-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    26007

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:26007

    UCSC genome browser

    More...
    UCSCi
    uc001nre.4 human [Q3LXA3-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    DQ138290 mRNA Translation: ABA10576.1
    DQ344550 mRNA Translation: ABC70184.1
    AK023915 mRNA Translation: BAB14722.1
    AK223580 mRNA Translation: BAD97300.1
    AP003108 Genomic DNA No translation available.
    BC001341 mRNA Translation: AAH01341.1
    CCDSiCCDS8003.1 [Q3LXA3-1]
    RefSeqiNP_056348.2, NM_015533.3 [Q3LXA3-1]
    XP_016873010.1, XM_017017521.1
    XP_016873012.1, XM_017017523.1

    3D structure databases

    SMRiQ3LXA3
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGridi117481, 28 interactors
    DIPiDIP-60967N
    IntActiQ3LXA3, 8 interactors
    STRINGi9606.ENSP00000378360

    PTM databases

    iPTMnetiQ3LXA3
    PhosphoSitePlusiQ3LXA3

    Polymorphism and mutation databases

    BioMutaiTKFC
    DMDMi311033370

    2D gel databases

    REPRODUCTION-2DPAGEiIPI00551024

    Proteomic databases

    CPTACiCPTAC-188
    CPTAC-189
    EPDiQ3LXA3
    jPOSTiQ3LXA3
    MassIVEiQ3LXA3
    MaxQBiQ3LXA3
    PaxDbiQ3LXA3
    PeptideAtlasiQ3LXA3
    PRIDEiQ3LXA3
    ProteomicsDBi61779 [Q3LXA3-1]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    26007

    Genome annotation databases

    EnsembliENST00000394900; ENSP00000378360; ENSG00000149476 [Q3LXA3-1]
    GeneIDi26007
    KEGGihsa:26007
    UCSCiuc001nre.4 human [Q3LXA3-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    26007
    DisGeNETi26007

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    TKFC
    HGNCiHGNC:24552 TKFC
    HPAiHPA039486
    HPA048186
    MIMi615844 gene
    neXtProtiNX_Q3LXA3
    OpenTargetsiENSG00000149476
    PharmGKBiPA142672014

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG2426 Eukaryota
    COG2376 LUCA
    GeneTreeiENSGT00390000015415
    HOGENOMiHOG000234158
    InParanoidiQ3LXA3
    KOiK00863
    OMAiTALNMNG
    OrthoDBi472175at2759
    PhylomeDBiQ3LXA3
    TreeFamiTF313821

    Enzyme and pathway databases

    BRENDAi2.7.1.29 2681
    4.6.1.15 2681
    ReactomeiR-HSA-168928 DDX58/IFIH1-mediated induction of interferon-alpha/beta
    R-HSA-70350 Fructose catabolism

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    TKFC human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    DAK_(gene)

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    26007
    PharosiQ3LXA3
    PMAP-CutDBiQ3LXA3

    Protein Ontology

    More...
    PROi
    PR:Q3LXA3

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000149476 Expressed in 165 organ(s), highest expression level in right adrenal gland
    ExpressionAtlasiQ3LXA3 baseline and differential
    GenevisibleiQ3LXA3 HS

    Family and domain databases

    Gene3Di1.25.40.340, 1 hit
    InterProiView protein in InterPro
    IPR012734 DhaK_ATP
    IPR004006 DhaK_dom
    IPR004007 DhaL_dom
    IPR036117 DhaL_dom_sf
    PfamiView protein in Pfam
    PF02733 Dak1, 1 hit
    PF02734 Dak2, 1 hit
    SMARTiView protein in SMART
    SM01120 Dak2, 1 hit
    SUPFAMiSSF101473 SSF101473, 1 hit
    TIGRFAMsiTIGR02361 dak_ATP, 1 hit
    PROSITEiView protein in PROSITE
    PS51481 DHAK, 1 hit
    PS51480 DHAL, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTKFC_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3LXA3
    Secondary accession number(s): Q2L9C1
    , Q53EQ9, Q9BVA7, Q9H895
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2006
    Last sequence update: November 2, 2010
    Last modified: October 16, 2019
    This is version 133 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. SIMILARITY comments
      Index of protein domains and families
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again