Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 142 (18 Sep 2019)
Sequence version 2 (21 Jun 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

InaD-like protein

Gene

Patj

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Scaffolding protein that may bring different proteins into adjacent positions at the cell membrane (By similarity). May regulate protein targeting, cell polarity and integrity of tight junctions (By similarity). May regulate the surface expression and/or function of ASIC3 in sensory neurons (PubMed:11872753). May recruit ARHGEF18 to apical cell-cell boundaries (By similarity).By similarity1 Publication

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
InaD-like protein
Short name:
Inadl protein
Alternative name(s):
Channel-interacting PDZ domain-containing protein1 Publication
Pals1-associated tight junction protein1 Publication
Protein associated to tight junctionsBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PatjImported
Synonyms:Cipp1 Publication, InadlBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1277960 Patj

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Tight junction

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945931 – 1834InaD-like proteinAdd BLAST1834

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei455PhosphoserineCombined sources1
Modified residuei459PhosphoserineBy similarity1
Modified residuei482PhosphoserineCombined sources1
Modified residuei524PhosphoserineCombined sources1
Modified residuei647PhosphoserineCombined sources1
Modified residuei1215PhosphoserineCombined sources1
Modified residuei1543PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q63ZW7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q63ZW7

PeptideAtlas

More...
PeptideAtlasi
Q63ZW7

PRoteomics IDEntifications database

More...
PRIDEi
Q63ZW7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q63ZW7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q63ZW7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed exclusively in brain and kidney. Isoform 3 might be brain-specific. In brain, high levels are detected in the cerebellum, inferior colliculus, vestibular nucleus, facial nucleus and thalamus. Also detected in deep cerebellar nuclei, superior colliculus, dorsal transition zone, brain stem, as well as the glomerular and mitral cell layers of the olfactory bulb. Within the cerebellum it is expressed in both Purkinje and granule cell layers.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000061859 Expressed in 254 organ(s), highest expression level in nucleus of brain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q63ZW7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q63ZW7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a ternary complex with MPP5 and CRB1 (By similarity).

Component of a complex whose core is composed of ARHGAP17, AMOT, MPP5/PALS1, INADL/PATJ and PARD3/PAR3 (By similarity).

Forms a heterotrimeric complex composed of MMP5, LIN7B and PATJ; the N-terminal L27 domain of MPP5 interacts with the L27 domain of PATJ and the C-terminal L27 domain of MPP5 interacts with the L27 domain of LIN7B (By similarity).

Interacts with TJP3/ZO-3 and CLDN1/claudin-1 (By similarity).

Interacts with ASIC3, KCNJ10, KCNJ15, GRIN2A, GRIN2B, GRIN2C, GRIN2D, NLGN2, and HTR2A (PubMed:9647694, PubMed:11872753, PubMed:14988405).

Interacts with MPP7 (By similarity). Directly interacts with HTR4 (PubMed:15466885).

Interacts (via PDZ domain 8) with WWC1 (via the ADDV motif) (By similarity).

Interacts with SLC6A4 (PubMed:17452640).

Interacts (via C-terminus) with ARHGEF18 (By similarity).

Interacts with NPHP1 (By similarity).

Isoform 2 interacts with NRXN2 (PubMed:9647694).

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
198715, 28 interactors

Database of interacting proteins

More...
DIPi
DIP-41238N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q63ZW7

Protein interaction database and analysis system

More...
IntActi
Q63ZW7, 16 interactors

Molecular INTeraction database

More...
MINTi
Q63ZW7

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000049176

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q63ZW7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 65L27PROSITE-ProRule annotationAdd BLAST65
Domaini134 – 221PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini248 – 328PDZ 2PROSITE-ProRule annotationAdd BLAST81
Domaini365 – 453PDZ 3PROSITE-ProRule annotationAdd BLAST89
Domaini555 – 641PDZ 4PROSITE-ProRule annotationAdd BLAST87
Domaini688 – 774PDZ 5PROSITE-ProRule annotationAdd BLAST87
Domaini1074 – 1166PDZ 6PROSITE-ProRule annotationAdd BLAST93
Domaini1245 – 1328PDZ 7PROSITE-ProRule annotationAdd BLAST84
Domaini1472 – 1555PDZ 8PROSITE-ProRule annotationAdd BLAST84
Domaini1568 – 1650PDZ 9PROSITE-ProRule annotationAdd BLAST83
Domaini1709 – 1795PDZ 10PROSITE-ProRule annotationAdd BLAST87

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The L27 domain (also called Maguk recruitment domain) is required for interaction with MPP5 and CRB3, and MPP5 localization to tight junctions.By similarity
The PDZ domain 6 mediates interaction with the C-terminus of TJP3 and is crucial for localization to the tight junctions. The PDZ domain 8 interacts with CLDN1 but is not required for proper localization (By similarity). The PDZ domain 2 of isoform 3 mediates interactions with KCNJ10, KCNJ15, GRIN2B and NLGN2. The PDZ domain 3 of isoform 3 mediates interactions with KCNJ15, GRIN2A, GRIN2B, GRIN2C, GRIN2D and NRXN2. The PDZ domain 4 of isoform 3 mediates interaction with ASIC3.By similarity2 Publications

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0708 Eukaryota
KOG3528 Eukaryota
ENOG410Y9M6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155136

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q63ZW7

KEGG Orthology (KO)

More...
KOi
K06092

Identification of Orthologs from Complete Genome Data

More...
OMAi
MKENFGI

Database of Orthologous Groups

More...
OrthoDBi
1419918at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q63ZW7

TreeFam database of animal gene trees

More...
TreeFami
TF330709

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015132 L27_2
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09045 L27_2, 1 hit
PF00595 PDZ, 10 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00569 L27, 1 hit
SM00228 PDZ, 10 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101288 SSF101288, 1 hit
SSF50156 SSF50156, 10 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51022 L27, 1 hit
PS50106 PDZ, 10 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q63ZW7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPENPAAEKM QVLQVLDRLR GKLQEKGDTT QNEKLSAFYE TLKSPLFNQI
60 70 80 90 100
LTLQQSIKQL KGQLSHIPSD CSANFDFSRK GLLVFTDGSI TNGNAQRPCS
110 120 130 140 150
NVTASELLPW TQKSASEDFN SVIQQMAQGR HVEYIDIERP STGGLGFSVV
160 170 180 190 200
ALRSQSLGLI DIFVKEVHPG SVADRDHRLK ENDQILAIND TPLDQNISHQ
210 220 230 240 250
QAIALLQQAT GSLRLVVARE VGHTQGRAST SSADTTLPET VCWGHTEEVE
260 270 280 290 300
LINDGSGLGF GIVGGKSSGV VVRTIVPGGL ADRDGRLQTG DHILKIGGTN
310 320 330 340 350
VQGMTSEQVA QVLRNCGNSV RMLVARDPVG EIAVTPPTPV SLPVALPAVA
360 370 380 390 400
TRTLDSDRSP FETYSVELVK KDGQSLGIRI VGYVGTAHPG EASGIYVKSI
410 420 430 440 450
IPGSAAYHNG QIQVNDKIVA VDGVNIQGFA NQDVVEVLRN AGQVVHLTLV
460 470 480 490 500
RRKTSLSASP FEHSSSRETV AEPPKVPERA GSPKPEANLS VEAEEIGERL
510 520 530 540 550
DNLKNNTVQA LEKPDVYPEK VPGSPENELK SRWENLLGPD YEVMVATLDA
560 570 580 590 600
QIADDEELQK YSKLLPIHTL RLGMEVDSFD GHHYISSVAP GGPVDTLNLL
610 620 630 640 650
QPEDELLEVN GMQLYGKSRR EAVSFLKEVP PPFTLVCCRR LFDDEASVDE
660 670 680 690 700
PRTMEPALLE AEVDHSVDVN IEDDDDGELA LWSPEVKTVE LVKDCKGLGF
710 720 730 740 750
SILDYQDPLD PTRSVIVIRS LVADGVAERS GELLPGDRLV SVNEFSLDNA
760 770 780 790 800
TLAEAVEVLK AVPPGVVHLG ICKPLVEDEK EERFSLHSNN NGDSSEPADA
810 820 830 840 850
VHEIHSSLIL EAPQGFRDEP YLEELVDEPF LDLGKSLQFQ QKDVDSSSEA
860 870 880 890 900
WEMHEFLSPP LDGRGEEREM LVDEEYELYQ DHLRAMESNP PPPHIREAAP
910 920 930 940 950
ASPVLELQAG TQWLHANLSG GERLECHDAE SMMSAYPQEM QQYSYSTADM
960 970 980 990 1000
MEETFGLDSR APIPSSEGNG QHGRFDDMGH LHSLTSSSLD LGMMIPSDLQ
1010 1020 1030 1040 1050
GPGVLVDLPA VAQRREQEDL PLYRLPSARV VTKPSSHMGL VSSRHANAAC
1060 1070 1080 1090 1100
ELPEREEGEG EETPNFSHWG PPRIVEIFRE PNVSLGISIV GGQTVIKRLK
1110 1120 1130 1140 1150
NGEELKGIFI KQVLEDSPAG KTNALKTGDK ILEVSGVDLQ NASHAEAVEA
1160 1170 1180 1190 1200
IKSAGNPVVF VVQSLSSTPR VIPTVNNKGK TPAPNQDQNT QERKAKRHGT
1210 1220 1230 1240 1250
APPPMKLPPP YRAPSADMEG SEEDCALTDK KIRQRYADLP GELHIIELEK
1260 1270 1280 1290 1300
DKNGLGLSLA GNKDRSRMSI FVVGINPEGP AAADGRMRIG DELLEINNQI
1310 1320 1330 1340 1350
LYGRSHQNAS AIIKTAPTRV KLVFIRNEDA VSQMAVAPFP ELSHSPSPVE
1360 1370 1380 1390 1400
DLGGTELVSS EEESSVDAKH LPEPESSKPE DLSQVVDDNM VAEQQKESES
1410 1420 1430 1440 1450
PDSAACQIKQ QTYSTQVSSS SQDSPSSPAP LCQSAHADVT GSGNFQAPLP
1460 1470 1480 1490 1500
VDPAPLSVDP ATCPIVPGQE MIIEISKGRS GLGLSIVGGK DTPLDAIVIH
1510 1520 1530 1540 1550
EVYEEGAAAR DGRLWAGDQI LEVNGVDLRS SSHEEAITAL RQTPQKVRLV
1560 1570 1580 1590 1600
VYRDEAQYRD EENLEVFLVD LQKKTGRGLG LSIVGKRSGS GVFISDIVKG
1610 1620 1630 1640 1650
GAADLDGRLI RGDQILSVNG EDMRHASQET VATILKCVQG LVQLEIGRLR
1660 1670 1680 1690 1700
AGSWAASRKT SQNSQGDQHS AHSSCRPSFA PVITSLQNLV GTKRSSDPPQ
1710 1720 1730 1740 1750
KCTEEEPRTV EIIRELSDAL GISIAGGKGS PLGDIPIFIA MIQANGVAAR
1760 1770 1780 1790 1800
TQKLKVGDRI VSINGQPLDG LSHTDAVNLL KNAFGRIILQ VVADTNISAI
1810 1820 1830
ATQLEIMSAG SQLGSPTADR HPEDTEEQMQ RTAD
Length:1,834
Mass (Da):198,517
Last modified:June 21, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i177ADF8E12B82A30
GO
Isoform 2 (identifier: Q63ZW7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-573: Missing.

Show »
Length:1,261
Mass (Da):136,621
Checksum:i4A787DBB7088CC37
GO
Isoform 3 (identifier: Q63ZW7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1222: Missing.
     1223-1230: EDCALTDK → MVHGGFPE

Show »
Length:612
Mass (Da):65,420
Checksum:i145DE1769F54BE56
GO
Isoform 4 (identifier: Q63ZW7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1222: Missing.
     1223-1230: EDCALTDK → MVHGGFPE
     1792-1804: VADTNISAIATQL → FRSMENQLAEADK
     1805-1834: Missing.

Note: No experimental confirmation available.
Show »
Length:582
Mass (Da):62,372
Checksum:i9F3C4D154F62B7A6
GO
Isoform 5 (identifier: Q63ZW7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     564-598: LLPIHTLRLGMEVDSFDGHHYISSVAPGGPVDTLN → WMLVLKAKAVPPSALHVVGSRAHIRRYKMALTAVF
     599-1834: Missing.

Note: No experimental confirmation available.
Show »
Length:598
Mass (Da):64,700
Checksum:i3853286E3870BF7B
GO
Isoform 6 (identifier: Q63ZW7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     951-975: MEETFGLDSRAPIPSSEGNGQHGRF → VRLCDTATTCSPLCPHTPRSCYFHS
     976-1834: Missing.

Note: No experimental confirmation available.
Show »
Length:975
Mass (Da):106,626
Checksum:i9A1BE05E01FB2459
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2ADS6A2ADS6_MOUSE
InaD-like protein
Patj Inadl
1,531Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2ADS8A2ADS8_MOUSE
InaD-like protein
Patj Inadl
902Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2ADT1A2ADT1_MOUSE
InaD-like protein
Patj Inadl
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6RSZ8F6RSZ8_MOUSE
InaD-like protein
Patj Inadl
454Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti740V → L in BAC36720 (PubMed:16141072).Curated1
Sequence conflicti986S → R in BAC36720 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0142101 – 1222Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST1222
Alternative sequenceiVSP_0142111 – 573Missing in isoform 2. 1 PublicationAdd BLAST573
Alternative sequenceiVSP_014212564 – 598LLPIH…VDTLN → WMLVLKAKAVPPSALHVVGS RAHIRRYKMALTAVF in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_014213599 – 1834Missing in isoform 5. 1 PublicationAdd BLAST1236
Alternative sequenceiVSP_014214951 – 975MEETF…QHGRF → VRLCDTATTCSPLCPHTPRS CYFHS in isoform 6. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_014215976 – 1834Missing in isoform 6. 1 PublicationAdd BLAST859
Alternative sequenceiVSP_0142161223 – 1230EDCALTDK → MVHGGFPE in isoform 3 and isoform 4. 2 Publications8
Alternative sequenceiVSP_0142171792 – 1804VADTN…IATQL → FRSMENQLAEADK in isoform 4. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0142181805 – 1834Missing in isoform 4. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF060539 mRNA Translation: AAC40148.1
AK077268 mRNA Translation: BAC36720.1
AL671229 Genomic DNA No translation available.
BC037607 mRNA Translation: AAH37607.1
BC050846 mRNA Translation: AAH50846.1
BC057124 mRNA Translation: AAH57124.1
BC062194 mRNA Translation: AAH62194.1
BC082787 mRNA Translation: AAH82787.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18375.1 [Q63ZW7-1]
CCDS18376.1 [Q63ZW7-3]
CCDS18377.1 [Q63ZW7-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001005784.1, NM_001005784.1 [Q63ZW7-6]
NP_001005787.1, NM_001005787.1 [Q63ZW7-4]
NP_031730.1, NM_007704.2 [Q63ZW7-3]
NP_766284.2, NM_172696.2 [Q63ZW7-1]
XP_006502762.1, XM_006502699.2 [Q63ZW7-1]
XP_006502763.1, XM_006502700.2 [Q63ZW7-1]
XP_006502764.1, XM_006502701.1 [Q63ZW7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000030290; ENSMUSP00000030290; ENSMUSG00000061859 [Q63ZW7-4]
ENSMUST00000041284; ENSMUSP00000049176; ENSMUSG00000061859 [Q63ZW7-1]
ENSMUST00000102792; ENSMUSP00000099854; ENSMUSG00000061859 [Q63ZW7-3]
ENSMUST00000107029; ENSMUSP00000102644; ENSMUSG00000061859 [Q63ZW7-2]
ENSMUST00000107030; ENSMUSP00000102645; ENSMUSG00000061859 [Q63ZW7-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
12695

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:12695

UCSC genome browser

More...
UCSCi
uc008tub.1 mouse [Q63ZW7-6]
uc008tuc.1 mouse [Q63ZW7-1]
uc008tug.1 mouse [Q63ZW7-4]
uc008tuh.1 mouse [Q63ZW7-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF060539 mRNA Translation: AAC40148.1
AK077268 mRNA Translation: BAC36720.1
AL671229 Genomic DNA No translation available.
BC037607 mRNA Translation: AAH37607.1
BC050846 mRNA Translation: AAH50846.1
BC057124 mRNA Translation: AAH57124.1
BC062194 mRNA Translation: AAH62194.1
BC082787 mRNA Translation: AAH82787.1
CCDSiCCDS18375.1 [Q63ZW7-1]
CCDS18376.1 [Q63ZW7-3]
CCDS18377.1 [Q63ZW7-4]
RefSeqiNP_001005784.1, NM_001005784.1 [Q63ZW7-6]
NP_001005787.1, NM_001005787.1 [Q63ZW7-4]
NP_031730.1, NM_007704.2 [Q63ZW7-3]
NP_766284.2, NM_172696.2 [Q63ZW7-1]
XP_006502762.1, XM_006502699.2 [Q63ZW7-1]
XP_006502763.1, XM_006502700.2 [Q63ZW7-1]
XP_006502764.1, XM_006502701.1 [Q63ZW7-1]

3D structure databases

SMRiQ63ZW7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi198715, 28 interactors
DIPiDIP-41238N
ELMiQ63ZW7
IntActiQ63ZW7, 16 interactors
MINTiQ63ZW7
STRINGi10090.ENSMUSP00000049176

PTM databases

iPTMnetiQ63ZW7
PhosphoSitePlusiQ63ZW7

Proteomic databases

jPOSTiQ63ZW7
PaxDbiQ63ZW7
PeptideAtlasiQ63ZW7
PRIDEiQ63ZW7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000030290; ENSMUSP00000030290; ENSMUSG00000061859 [Q63ZW7-4]
ENSMUST00000041284; ENSMUSP00000049176; ENSMUSG00000061859 [Q63ZW7-1]
ENSMUST00000102792; ENSMUSP00000099854; ENSMUSG00000061859 [Q63ZW7-3]
ENSMUST00000107029; ENSMUSP00000102644; ENSMUSG00000061859 [Q63ZW7-2]
ENSMUST00000107030; ENSMUSP00000102645; ENSMUSG00000061859 [Q63ZW7-5]
GeneIDi12695
KEGGimmu:12695
UCSCiuc008tub.1 mouse [Q63ZW7-6]
uc008tuc.1 mouse [Q63ZW7-1]
uc008tug.1 mouse [Q63ZW7-4]
uc008tuh.1 mouse [Q63ZW7-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10207
MGIiMGI:1277960 Patj

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
KOG3528 Eukaryota
ENOG410Y9M6 LUCA
GeneTreeiENSGT00940000155136
InParanoidiQ63ZW7
KOiK06092
OMAiMKENFGI
OrthoDBi1419918at2759
PhylomeDBiQ63ZW7
TreeFamiTF330709

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q63ZW7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000061859 Expressed in 254 organ(s), highest expression level in nucleus of brain
ExpressionAtlasiQ63ZW7 baseline and differential
GenevisibleiQ63ZW7 MM

Family and domain databases

InterProiView protein in InterPro
IPR015132 L27_2
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
PfamiView protein in Pfam
PF09045 L27_2, 1 hit
PF00595 PDZ, 10 hits
SMARTiView protein in SMART
SM00569 L27, 1 hit
SM00228 PDZ, 10 hits
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50156 SSF50156, 10 hits
PROSITEiView protein in PROSITE
PS51022 L27, 1 hit
PS50106 PDZ, 10 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiINADL_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q63ZW7
Secondary accession number(s): A2ADS7
, O70471, Q5PRG3, Q6P6J1, Q80YR8, Q8BPB9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: June 21, 2005
Last modified: September 18, 2019
This is version 142 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again