Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 129 (18 Sep 2019)
Sequence version 2 (31 Aug 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Progestin and adipoQ receptor family member 3

Gene

PAQR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a spatial regulator of RAF1 kinase by sequestrating it to the Golgi.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5675221 Negative regulation of MAPK pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Progestin and adipoQ receptor family member 31 Publication
Alternative name(s):
Progestin and adipoQ receptor family member III
Raf kinase trapping to Golgi1 Publication
Short name:
RKTG1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PAQR3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30130 PAQR3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614577 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6TCH7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 73CytoplasmicSequence analysisAdd BLAST73
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei74 – 96HelicalSequence analysisAdd BLAST23
Topological domaini97 – 105LumenalSequence analysis9
Transmembranei106 – 128HelicalSequence analysisAdd BLAST23
Topological domaini129 – 140CytoplasmicSequence analysisAdd BLAST12
Transmembranei141 – 163HelicalSequence analysisAdd BLAST23
Topological domaini164 – 172LumenalSequence analysis9
Transmembranei173 – 195HelicalSequence analysisAdd BLAST23
Topological domaini196 – 201CytoplasmicSequence analysis6
Transmembranei202 – 224HelicalSequence analysisAdd BLAST23
Topological domaini225 – 238LumenalSequence analysisAdd BLAST14
Transmembranei239 – 256HelicalSequence analysisAdd BLAST18
Topological domaini257 – 275CytoplasmicSequence analysisAdd BLAST19
Transmembranei276 – 298HelicalSequence analysisAdd BLAST23
Topological domaini299 – 311LumenalSequence analysisAdd BLAST13

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
152559

Open Targets

More...
OpenTargetsi
ENSG00000163291

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134952039

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6TCH7

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PAQR3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
51701774

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002188461 – 311Progestin and adipoQ receptor family member 3Add BLAST311

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6TCH7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6TCH7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6TCH7

PeptideAtlas

More...
PeptideAtlasi
Q6TCH7

PRoteomics IDEntifications database

More...
PRIDEi
Q6TCH7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
67380 [Q6TCH7-1]
67381 [Q6TCH7-2]
67382 [Q6TCH7-3]
67383 [Q6TCH7-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6TCH7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6TCH7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed in a range of tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163291 Expressed in 210 organ(s), highest expression level in sperm

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6TCH7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6TCH7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA058453

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
RAF1P040493EBI-15654365,EBI-365996

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127451, 7 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q6TCH7

Database of interacting proteins

More...
DIPi
DIP-46464N

Protein interaction database and analysis system

More...
IntActi
Q6TCH7, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000421981

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6TCH7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni61 – 71Golgi targetingAdd BLAST11
Regioni299 – 303Golgi targeting5

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ADIPOR family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0748 Eukaryota
COG1272 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155291

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007783

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6TCH7

Identification of Orthologs from Complete Genome Data

More...
OMAi
EPNVLGH

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6TCH7

TreeFam database of animal gene trees

More...
TreeFami
TF313640

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004254 AdipoR/HlyIII-related

The PANTHER Classification System

More...
PANTHERi
PTHR20855 PTHR20855, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03006 HlyIII, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6TCH7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHQKLLKSAH YIELGSYQYW PVLVPRGIRL YTYEQIPGSL KDNPYITDGY
60 70 80 90 100
RAYLPSRLCI KSLFILSNET VNIWSHLLGF FLFFTLGIYD MTSVLPSASA
110 120 130 140 150
SREDFVICSI CLFCFQVCML CSVGYHLFSC HRSEKTCRRW MALDYAGISI
160 170 180 190 200
GILGCYVSGV FYAFYCNNYW RQVYLITVLA MILAVFFAQI HPNYLTQQWQ
210 220 230 240 250
RLRSIIFCSV SGYGVIPTLH WVWLNGGIGA PIVQDFAPRV IVMYMIALLA
260 270 280 290 300
FLFYISKVPE RYFPGQLNYL GSSHQIWHIL AVVMLYWWHQ STVYVMQYRH
310
SKPCPDYVSH L
Length:311
Mass (Da):36,217
Last modified:August 31, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8C629920D0F8D785
GO
Isoform 2 (identifier: Q6TCH7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ENIFRWEITKRTLGGVNNSLQNLYLLV

Note: No experimental confirmation available.
Show »
Length:291
Mass (Da):33,735
Checksum:iA11C6CD458D86096
GO
Isoform 3 (identifier: Q6TCH7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ESLPR

Note: No experimental confirmation available.
Show »
Length:269
Mass (Da):31,144
Checksum:i55B9A69DBEED4F92
GO
Isoform 4 (identifier: Q6TCH7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-88: SLFILSNETVNIWSHLLGFFLFFTLGI → RSVCFALWAIIFFPAIGQKKHVEDGWH
     89-311: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:88
Mass (Da):10,357
Checksum:iC7733512C770502E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W784F8W784_HUMAN
Progestin and adipoQ receptor famil...
PAQR3
291Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDU4D6RDU4_HUMAN
Progestin and adipoQ receptor famil...
PAQR3
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAG51571 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti30L → Q in BAF83921 (PubMed:14702039).Curated1
Sequence conflicti258V → A in AAR08369 (PubMed:16044242).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01147762 – 88SLFIL…FTLGI → RSVCFALWAIIFFPAIGQKK HVEDGWH in isoform 4. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_01147889 – 311Missing in isoform 4. 1 PublicationAdd BLAST223
Alternative sequenceiVSP_011479265 – 311GQLNY…YVSHL → ENIFRWEITKRTLGGVNNSL QNLYLLV in isoform 2. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_011480265 – 311GQLNY…YVSHL → ESLPR in isoform 3. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY424281 mRNA Translation: AAR08369.1
AK055774 mRNA Translation: BAG51571.1 Different initiation.
AK291232 mRNA Translation: BAF83921.1
BC029604 mRNA No translation available.
BC031256 mRNA Translation: AAH31256.1
BC047510 mRNA Translation: AAH47510.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34020.1 [Q6TCH7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001035292.1, NM_001040202.1 [Q6TCH7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000395594; ENSP00000378959; ENSG00000163291 [Q6TCH7-3]
ENST00000511594; ENSP00000425080; ENSG00000163291 [Q6TCH7-1]
ENST00000512733; ENSP00000421981; ENSG00000163291 [Q6TCH7-1]
ENST00000512760; ENSP00000426875; ENSG00000163291 [Q6TCH7-4]
ENST00000515853; ENSP00000422357; ENSG00000163291 [Q6TCH7-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
152559

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:152559

UCSC genome browser

More...
UCSCi
uc003hlp.2 human [Q6TCH7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY424281 mRNA Translation: AAR08369.1
AK055774 mRNA Translation: BAG51571.1 Different initiation.
AK291232 mRNA Translation: BAF83921.1
BC029604 mRNA No translation available.
BC031256 mRNA Translation: AAH31256.1
BC047510 mRNA Translation: AAH47510.1
CCDSiCCDS34020.1 [Q6TCH7-1]
RefSeqiNP_001035292.1, NM_001040202.1 [Q6TCH7-1]

3D structure databases

SMRiQ6TCH7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi127451, 7 interactors
CORUMiQ6TCH7
DIPiDIP-46464N
IntActiQ6TCH7, 1 interactor
STRINGi9606.ENSP00000421981

PTM databases

iPTMnetiQ6TCH7
PhosphoSitePlusiQ6TCH7

Polymorphism and mutation databases

BioMutaiPAQR3
DMDMi51701774

Proteomic databases

MassIVEiQ6TCH7
MaxQBiQ6TCH7
PaxDbiQ6TCH7
PeptideAtlasiQ6TCH7
PRIDEiQ6TCH7
ProteomicsDBi67380 [Q6TCH7-1]
67381 [Q6TCH7-2]
67382 [Q6TCH7-3]
67383 [Q6TCH7-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
152559

Genome annotation databases

EnsembliENST00000395594; ENSP00000378959; ENSG00000163291 [Q6TCH7-3]
ENST00000511594; ENSP00000425080; ENSG00000163291 [Q6TCH7-1]
ENST00000512733; ENSP00000421981; ENSG00000163291 [Q6TCH7-1]
ENST00000512760; ENSP00000426875; ENSG00000163291 [Q6TCH7-4]
ENST00000515853; ENSP00000422357; ENSG00000163291 [Q6TCH7-4]
GeneIDi152559
KEGGihsa:152559
UCSCiuc003hlp.2 human [Q6TCH7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
152559
DisGeNETi152559

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PAQR3
HGNCiHGNC:30130 PAQR3
HPAiHPA058453
MIMi614577 gene
neXtProtiNX_Q6TCH7
OpenTargetsiENSG00000163291
PharmGKBiPA134952039

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0748 Eukaryota
COG1272 LUCA
GeneTreeiENSGT00940000155291
HOGENOMiHOG000007783
InParanoidiQ6TCH7
OMAiEPNVLGH
PhylomeDBiQ6TCH7
TreeFamiTF313640

Enzyme and pathway databases

ReactomeiR-HSA-5675221 Negative regulation of MAPK pathway

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PAQR3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
152559
PharosiQ6TCH7

Protein Ontology

More...
PROi
PR:Q6TCH7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000163291 Expressed in 210 organ(s), highest expression level in sperm
ExpressionAtlasiQ6TCH7 baseline and differential
GenevisibleiQ6TCH7 HS

Family and domain databases

InterProiView protein in InterPro
IPR004254 AdipoR/HlyIII-related
PANTHERiPTHR20855 PTHR20855, 1 hit
PfamiView protein in Pfam
PF03006 HlyIII, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPAQR3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6TCH7
Secondary accession number(s): A8K5B7
, B3KP59, Q6PIQ1, Q86X05, Q8NCP9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: September 18, 2019
This is version 129 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again