Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (16 Oct 2019)
Sequence version 2 (21 Feb 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

C-myc promoter-binding protein

Gene

DENND4A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable guanine nucleotide exchange factor (GEF) which may activate RAB10. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. According to PubMed:8056341, it may bind to ISRE-like element (interferon-stimulated response element) of MYC P2 promoter.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Guanine-nucleotide releasing factor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-myc promoter-binding protein
Alternative name(s):
DENN domain-containing protein 4A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DENND4A
Synonyms:IRLB, MYCPBP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24321 DENND4A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600382 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q7Z401

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10260

Open Targets

More...
OpenTargetsi
ENSG00000174485

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134887513

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q7Z401

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DENND4A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
88909230

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002239521 – 1863C-myc promoter-binding proteinAdd BLAST1863

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei731PhosphoserineCombined sources1
Modified residuei1015PhosphoserineCombined sources1
Modified residuei1035PhosphoserineCombined sources1
Modified residuei1099PhosphoserineCombined sources1
Modified residuei1151PhosphoserineCombined sources1
Modified residuei1152PhosphoserineCombined sources1
Modified residuei1225PhosphoserineCombined sources1
Modified residuei1240PhosphoserineCombined sources1
Modified residuei1251PhosphoserineCombined sources1
Modified residuei1281PhosphoserineCombined sources1
Modified residuei1508PhosphoserineCombined sources1
Modified residuei1587PhosphoserineCombined sources1
Modified residuei1589PhosphoserineCombined sources1
Modified residuei1591PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q7Z401

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q7Z401

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q7Z401

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q7Z401

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q7Z401

PeptideAtlas

More...
PeptideAtlasi
Q7Z401

PRoteomics IDEntifications database

More...
PRIDEi
Q7Z401

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
17383
69104 [Q7Z401-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7Z401

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q7Z401

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed ubiquitously. Highest expression in bone marrow, medium in peripheral blood lymphocytes and lowest in spleen. In brain, breast, and prostate, higher expression was seen in normal cells than in tumor cells. Expression is regulated in a growth- and cell cycle-dependent manner.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Highly expressed in fetal liver.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By serum in low-passage fibroblasts.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000174485 Expressed in 186 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7Z401 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7Z401 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA065343

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
YWHAZP631042EBI-1046479,EBI-347088

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115552, 43 interactors

Protein interaction database and analysis system

More...
IntActi
Q7Z401, 18 interactors

Molecular INTeraction database

More...
MINTi
Q7Z401

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000391167

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q7Z401

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini42 – 200MABPPROSITE-ProRule annotationAdd BLAST159
Domaini192 – 364uDENNPROSITE-ProRule annotationAdd BLAST173
Domaini385 – 521cDENNPROSITE-ProRule annotationAdd BLAST137
Domaini523 – 641dDENNPROSITE-ProRule annotationAdd BLAST119
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati772 – 808PPR 1Add BLAST37
Repeati809 – 843PPR 2Add BLAST35

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi917 – 933Bipartite nuclear localization signalSequence analysisAdd BLAST17

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1183 – 1189Poly-Glu7

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2127 Eukaryota
ENOG410XQMX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155836

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231590

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7Z401

KEGG Orthology (KO)

More...
KOi
K20163

Database of Orthologous Groups

More...
OrthoDBi
75304at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q7Z401

TreeFam database of animal gene trees

More...
TreeFami
TF313237

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001194 cDENN_dom
IPR005112 dDENN_dom
IPR023341 MABP
IPR002885 Pentatricopeptide_repeat
IPR011990 TPR-like_helical_dom_sf
IPR037516 Tripartite_DENN
IPR005113 uDENN_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03455 dDENN, 1 hit
PF02141 DENN, 1 hit
PF03456 uDENN, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00801 dDENN, 1 hit
SM00799 DENN, 1 hit
SM00800 uDENN, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00756 PPR, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50211 DENN, 1 hit
PS51498 MABP, 1 hit
PS51375 PPR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7Z401-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIEDKGPRVA DYFVVAGLTD VSKPLEEEIH FNDACHKVAK PKEPITDVSV
60 70 80 90 100
IIKSLGEEVP QDYICIDVTP TGLSADLNNG SLVGPQIYLC YRRGRDKPPL
110 120 130 140 150
TDLGVLYDWK ERLKQGCEII QSTPYGRPAN ISGSTSSQRI YITYRRASEN
160 170 180 190 200
MTQNTLAVTD ICIIIPSKGE SPPHTFCKVD KNLNNSMWGS AVYLCYKKSV
210 220 230 240 250
AKTNTVSYKA GLICRYPQED YESFSLPESV PLFCLPMGAT IECWPSNSKY
260 270 280 290 300
PLPVFSTFVL TGASAEKVYG AAIQFYEPYS EENLTEKQRL LLGLTSADGK
310 320 330 340 350
SDSSKTIHTN KCICLLSHWP FFDAFRKFLT FLYRYSISGP HVLPIEKHIS
360 370 380 390 400
HFMHKVPFPS PQRPRILVQL SPHDNLILSQ PVSSPLPLSG GKFSTLLQNL
410 420 430 440 450
GPENAVTLLV FAVTEHKILI HSLRPSVLTS VTEALVSMIF PFHWPCPYVP
460 470 480 490 500
LCPLALADVL SAPCPFIVGI DSRYFDLYDP PPDVSCVDVD TNTISQIGDK
510 520 530 540 550
KNVAWKILPK KPCKNLMNTL NNLHQQLAKL QQRPRDDGLM DLAINDYDFN
560 570 580 590 600
SGKRLHMIDL EIQEAFLFFM ASILKGYRSY LRPITQAPSE TATDAASLFA
610 620 630 640 650
LQAFLRSRDR SHQKFYNMMT KTQMFIRFIE ECSFVSDKDA SLAFFDDCVD
660 670 680 690 700
KVDMDKSGEV RLIELDESFK SEHTVFVTPP EIPHLPNGEE PPLQYSYNGF
710 720 730 740 750
PVLRNNLFER PEGFLQAKKN KLPSKSSSPN SPLPMFRRTK QEIKSAHKIA
760 770 780 790 800
KRYSSIPQMW SRCLLRHCYG LWFICLPAYV KVCHSKVRAL KTAYDVLKKM
810 820 830 840 850
QSKKMDPPDE VCYRILMQLC GQYDQPVLAV RVLFEMQKAG IDPNAITYGY
860 870 880 890 900
YNKAVLESTW PSRSRSGYFL WTKVRNVVLG VTQFKRALKK HAHLSQTTLS
910 920 930 940 950
GGQSDLGYNS LSKDEVRRGD TSTEDIQEEK DKKGSDCSSL SESESTKGSA
960 970 980 990 1000
DCLPKLSYQN SSSIVRLTGT SNNSAGKISG ESMESTPELL LISSLEDTNE
1010 1020 1030 1040 1050
TRNIQSRCFR KRHKSDNETN LQQQVVWGNR NRNLSGGVLM GFMLNRINQE
1060 1070 1080 1090 1100
ATPGDIVEKL GADAKILSNV ISKSTRPNTL DIGKPPLRSK RDSLEKESSD
1110 1120 1130 1140 1150
DDTPFDGSNY LADKVDSPVI FDLEDLDSET DVSKAGCVAT QNPKRIQRMN
1160 1170 1180 1190 1200
SSFSVKPFEK TDVATGFDPL SLLVAETEQQ QKEEEEEDED DSKSISTPSA
1210 1220 1230 1240 1250
RRDLAEEIVM YMNNMSSPLT SRTPSIDLQR ACDDKLNKKS PPLVKACRRS
1260 1270 1280 1290 1300
SLPPNSPKPV RLTKSKSYTK SEEKPRDRLW SSPAFSPTCP FREESQDTLT
1310 1320 1330 1340 1350
HSSPSFNLDT LLVPKLDVLR NSMFTAGKGV AEKASKWYSR FTMYTTSSKD
1360 1370 1380 1390 1400
QSSDRTSLSS VGAQDSESTS LTDEDVCHEL EGPISSQETS ATSGTKRIDL
1410 1420 1430 1440 1450
SRISLESSAS LEGSLSKFAL PGKSEVTSSF NASNTNIFQN YAMEVLISSC
1460 1470 1480 1490 1500
SRCRTCDCLV HDEEIMAGWT ADDSNLNTTC PFCGNIFLPF LNIEIRDLRR
1510 1520 1530 1540 1550
PGRYFLKSSP STENMHFPSS ISSQTRQSCI STSASGLDTS ALSVQGNFDL
1560 1570 1580 1590 1600
NSKSKLQENF CTRSIQIPAN RSKTAMSKCP IFPMARSIST SGPLDKEDTG
1610 1620 1630 1640 1650
RQKLISTGSL PATLQGATDS LGLEWHLPSP DPVTVPYLSP LVVWKELESL
1660 1670 1680 1690 1700
LENEGDHAIT VADFVDHHPI VFWNLVWYFR RLDLPSNLPG LILSSEHCNK
1710 1720 1730 1740 1750
YSKIPRHCMS EDSKYVLIQM LWDNMKLHQD PGQPLYILWN AHTQKYPMVH
1760 1770 1780 1790 1800
LLQKSDNSFN QELLKSMVKS IKMNDVYGPM SQILETLNKC PHFKRQRSLY
1810 1820 1830 1840 1850
REILFLSLVA LGRENIDIDA FDKEYKMAYD RLTPSQVKST HNCDRPPSTG
1860
VMECRKTFGE PYL
Length:1,863
Mass (Da):209,244
Last modified:February 21, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7432EEC9DB9711E6
GO
Isoform 2 (identifier: Q7Z401-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     900-900: S → SDGSDLDAVSHGSMDSGHGTHTVEQAPFNTGLIKVYATDDRSST

Note: No experimental confirmation available.
Show »
Length:1,906
Mass (Da):213,704
Checksum:i4A2E0BB91759E401
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BTW5H3BTW5_HUMAN
C-myc promoter-binding protein
DENND4A
1,001Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RR27A0A0U1RR27_HUMAN
C-myc promoter-binding protein
DENND4A
1,916Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSA0H3BSA0_HUMAN
C-myc promoter-binding protein
DENND4A
26Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AL833317 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti256S → P in AL833317 (PubMed:17974005).Curated1
Sequence conflicti383S → P in CAD89960 (PubMed:17974005).Curated1
Sequence conflicti983M → MGK in AAQ10514 (PubMed:12906859).Curated1
Sequence conflicti1532T → A in AL833317 (PubMed:17974005).Curated1
Sequence conflicti1726K → Q in AL833317 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_025362284L → P1 PublicationCorresponds to variant dbSNP:rs17854146Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044630900S → SDGSDLDAVSHGSMDSGHGT HTVEQAPFNTGLIKVYATDD RSST in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF534403 mRNA Translation: AAQ10514.1
AL832602 mRNA Translation: CAD89960.1
AL833317 mRNA No translation available.
AC011939 Genomic DNA No translation available.
BC041706 mRNA Translation: AAH41706.1
AK091368 mRNA Translation: BAC03648.1
X63417 mRNA Translation: CAA45013.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45285.1 [Q7Z401-1]
CCDS53949.1 [Q7Z401-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
I37904

NCBI Reference Sequences

More...
RefSeqi
NP_001138295.1, NM_001144823.2 [Q7Z401-2]
NP_005839.3, NM_005848.4 [Q7Z401-1]
XP_005254178.1, XM_005254121.3 [Q7Z401-1]
XP_016877352.1, XM_017021863.1 [Q7Z401-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000431932; ENSP00000396830; ENSG00000174485 [Q7Z401-1]
ENST00000443035; ENSP00000391167; ENSG00000174485 [Q7Z401-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10260

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10260

UCSC genome browser

More...
UCSCi
uc002aph.4 human [Q7Z401-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF534403 mRNA Translation: AAQ10514.1
AL832602 mRNA Translation: CAD89960.1
AL833317 mRNA No translation available.
AC011939 Genomic DNA No translation available.
BC041706 mRNA Translation: AAH41706.1
AK091368 mRNA Translation: BAC03648.1
X63417 mRNA Translation: CAA45013.1
CCDSiCCDS45285.1 [Q7Z401-1]
CCDS53949.1 [Q7Z401-2]
PIRiI37904
RefSeqiNP_001138295.1, NM_001144823.2 [Q7Z401-2]
NP_005839.3, NM_005848.4 [Q7Z401-1]
XP_005254178.1, XM_005254121.3 [Q7Z401-1]
XP_016877352.1, XM_017021863.1 [Q7Z401-1]

3D structure databases

SMRiQ7Z401
ModBaseiSearch...

Protein-protein interaction databases

BioGridi115552, 43 interactors
IntActiQ7Z401, 18 interactors
MINTiQ7Z401
STRINGi9606.ENSP00000391167

PTM databases

iPTMnetiQ7Z401
PhosphoSitePlusiQ7Z401

Polymorphism and mutation databases

BioMutaiDENND4A
DMDMi88909230

Proteomic databases

EPDiQ7Z401
jPOSTiQ7Z401
MassIVEiQ7Z401
MaxQBiQ7Z401
PaxDbiQ7Z401
PeptideAtlasiQ7Z401
PRIDEiQ7Z401
ProteomicsDBi17383
69104 [Q7Z401-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10260

Genome annotation databases

EnsembliENST00000431932; ENSP00000396830; ENSG00000174485 [Q7Z401-1]
ENST00000443035; ENSP00000391167; ENSG00000174485 [Q7Z401-2]
GeneIDi10260
KEGGihsa:10260
UCSCiuc002aph.4 human [Q7Z401-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10260
DisGeNETi10260

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DENND4A
HGNCiHGNC:24321 DENND4A
HPAiHPA065343
MIMi600382 gene
neXtProtiNX_Q7Z401
OpenTargetsiENSG00000174485
PharmGKBiPA134887513

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2127 Eukaryota
ENOG410XQMX LUCA
GeneTreeiENSGT00940000155836
HOGENOMiHOG000231590
InParanoidiQ7Z401
KOiK20163
OrthoDBi75304at2759
PhylomeDBiQ7Z401
TreeFamiTF313237

Enzyme and pathway databases

ReactomeiR-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DENND4A human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DENND4A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10260
PharosiQ7Z401

Protein Ontology

More...
PROi
PR:Q7Z401

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000174485 Expressed in 186 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ7Z401 baseline and differential
GenevisibleiQ7Z401 HS

Family and domain databases

Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR001194 cDENN_dom
IPR005112 dDENN_dom
IPR023341 MABP
IPR002885 Pentatricopeptide_repeat
IPR011990 TPR-like_helical_dom_sf
IPR037516 Tripartite_DENN
IPR005113 uDENN_dom
PfamiView protein in Pfam
PF03455 dDENN, 1 hit
PF02141 DENN, 1 hit
PF03456 uDENN, 1 hit
SMARTiView protein in SMART
SM00801 dDENN, 1 hit
SM00799 DENN, 1 hit
SM00800 uDENN, 1 hit
TIGRFAMsiTIGR00756 PPR, 1 hit
PROSITEiView protein in PROSITE
PS50211 DENN, 1 hit
PS51498 MABP, 1 hit
PS51375 PPR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYCPP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7Z401
Secondary accession number(s): E7EPL3
, Q14655, Q86T77, Q8IVX2, Q8NB93
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2006
Last sequence update: February 21, 2006
Last modified: October 16, 2019
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again