Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (16 Oct 2019)
Sequence version 2 (14 Nov 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Neuronal cell adhesion molecule

Gene

Nrcam

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell adhesion protein that is required for normal responses to cell-cell contacts in brain and in the peripheral nervous system. Plays a role in neurite outgrowth in response to contactin binding (PubMed:11564762). Plays a role in mediating cell-cell contacts between Schwann cells and axons (PubMed:20188654). Plays a role in the formation and maintenance of the nodes of Ranvier on myelinated axons. Nodes of Ranvier contain clustered sodium channels that are crucial for the saltatory propagation of action potentials along myelinated axons. During development, nodes of Ranvier are formed by the fusion of two heminodes. Required for normal clustering of sodium channels at heminodes; not required for the formation of mature nodes with normal sodium channel clusters (PubMed:14602817, PubMed:20188654). Required, together with GLDN, for maintaining NFASC and sodium channel clusters at mature nodes of Ranvier (PubMed:24719088).5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neuronal cell adhesion molecule
Short name:
Nr-CAM
Alternative name(s):
Neuronal surface protein Bravo
Short name:
mBravo
NgCAM-related cell adhesion molecule
Short name:
Ng-CAM-related
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nrcam
Synonyms:Kiaa0343
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:104750 Nrcam

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini30 – 1119ExtracellularSequence analysisAdd BLAST1090
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1120 – 1142HelicalSequence analysisAdd BLAST23
Topological domaini1143 – 1256CytoplasmicSequence analysisAdd BLAST114

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice are born at the expected Mendelian rate, are viable and fertile. They present no obvious phenotype excepting subtle size differences of cerebellar lobes IV and V. Contrary to wild-type, cerebellar cells do not form neurites when plated on a surface coated with contactin (in vitro) (PubMed:11564762). Neonates present delayed formation of sodium channel clusters at developing nodes of Ranvier, but are indistiguishable from wild-type at 10 days after birth (PubMed:14602817, PubMed:20188654). Mice lacking both Gldn and Nrcam are born at the expected Mendelian rate, but are smaller than control littermates and display important neurological impairments, in spite of seemingly normal nerve myelination. Motor abnormalities vary between individuals, ranging from ataxia, uncoordinated movements and premature death to weakness of the hind limbs, hypomotility, strongly impaired ability to hang from a horizontal bar with their forelimbs and a tendency to stumble. The motor defects correlate with decreased velocity of nerve conduction and slower propagation of action potentials. Most mice die within 60 days after birth, and none are fertile. Mutant mice display delayed formation of mature nodes of Ranvier; 15 days after birth about 20% of the nodes lack detectable sodium channel clusters. Sodium channel clustering and nerve conduction appear normal 60 and 75 days after birth, but subsequently a gradual disintegration of the nodal protein complexes is seen. About 70% of the mutant nodes present high-density sodium channel clustering at 120 days after birth, as opposed to nearly 100% for wild-type. Contrary to wild-type, in adult nodes of Ranvier the sodium channels are often clustered near the paranode border with an empty gap in the middle. At nodes of Ranvier, Schwann cell microvilli are sparse or absent and show defects in their orientation, resulting in various structural abnormalities at the node and the paranode border (PubMed:24719088).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 29Sequence analysisAdd BLAST29
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001505830 – 1256Neuronal cell adhesion moleculeAdd BLAST1227

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi62 ↔ 117PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi77N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi161 ↔ 212PROSITE-ProRule annotation
Glycosylationi217N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi239N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi245N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi270N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi286 ↔ 334PROSITE-ProRule annotation
Glycosylationi308N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi371N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi376 ↔ 426PROSITE-ProRule annotation
Glycosylationi427N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi470 ↔ 519PROSITE-ProRule annotation
Glycosylationi501N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi561 ↔ 610PROSITE-ProRule annotation
Glycosylationi613N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi710N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi796N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi852N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi987N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1003N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1013N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1067N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1173PhosphothreonineCombined sources1
Modified residuei1177PhosphotyrosineCombined sources1
Modified residuei1178PhosphoserineCombined sources1
Modified residuei1203PhosphoserineCombined sources1
Modified residuei1206PhosphoserineCombined sources1
Modified residuei1223PhosphoserineBy similarity1
Modified residuei1242PhosphoserineCombined sources1
Modified residuei1243PhosphoserineCombined sources1
Modified residuei1247PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q810U4

PeptideAtlas

More...
PeptideAtlasi
Q810U4

PRoteomics IDEntifications database

More...
PRIDEi
Q810U4

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2549

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q810U4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q810U4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in sciatic nerve (PubMed:14602817, PubMed:20188654, PubMed:24719088). Detected in brain, especially in the cerebellum Purkinje cell layer, inner granule cell layer and molecular layer (at protein level) (PubMed:11564762). Detected in neurons and Schwann cells (PubMed:20188654).4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000020598 Expressed in 221 organ(s), highest expression level in pineal body

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q810U4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q810U4 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Constituent of a NFASC/NRCAM/ankyrin-G complex (Probable). Detected in a complex with CNTN1 and PTPRB (PubMed:11564762).

Interacts with GLDN/gliomedin and MYOC (PubMed:16039564, PubMed:23897819).

1 Publication3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
235320, 4 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q810U4

Protein interaction database and analysis system

More...
IntActi
Q810U4, 5 interactors

Molecular INTeraction database

More...
MINTi
Q810U4

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000020939

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q810U4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 128Ig-like C2-type 1Add BLAST89
Domaini135 – 229Ig-like C2-type 2Add BLAST95
Domaini261 – 350Ig-like C2-type 3Add BLAST90
Domaini355 – 442Ig-like C2-type 4Add BLAST88
Domaini448 – 535Ig-like C2-type 5Add BLAST88
Domaini539 – 626Ig-like C2-type 6Add BLAST88
Domaini643 – 738Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST96
Domaini740 – 837Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST98
Domaini842 – 944Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST103
Domaini948 – 1045Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST98

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3513 Eukaryota
ENOG410XSVG LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155419

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231380

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q810U4

KEGG Orthology (KO)

More...
KOi
K06756

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q810U4

TreeFam database of animal gene trees

More...
TreeFami
TF351098

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 4 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 10 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003006 Ig/MHC_CS
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR026966 Neurofascin/L1/NrCAM_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13882 Bravo_FIGEY, 1 hit
PF00041 fn3, 4 hits
PF07679 I-set, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 4 hits
SM00409 IG, 6 hits
SM00408 IGc2, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 6 hits
SSF49265 SSF49265, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 4 hits
PS50835 IG_LIKE, 6 hits
PS00290 IG_MHC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q810U4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQLKIMPKKK HLSAGGVPLI LFLCQMISAL DVPLDLVQPP TITQQSPKDY
60 70 80 90 100
IIDPRENIVI QCEAKGKPPP SFSWTRNGTH FDIDKDPLVT MKPGSGTLVI
110 120 130 140 150
NIMSEGKAET YEGVYQCTAR NERGAAVSNN IVVRPSRSPL WTKERLEPIV
160 170 180 190 200
LQNGQSLVLP CRPPIGLPPA IIFWMDNSFQ RLPQSERVSQ GLNGDLYFSN
210 220 230 240 250
VLPEDTREDY ICYARFNHTQ TIQQKQPISL KVISVDELND TIAANLSDTE
260 270 280 290 300
FYGAKSSKER PPTFLTPEGN ESHKEELRGN VLSLECIAEG LPTPIIYWIK
310 320 330 340 350
EDGMLPANRT FYRNFKKTLQ ITHVSEADSG NYQCIAKNAL GAVHHTISVT
360 370 380 390 400
VKAAPYWIVA PQNLVLSPGE NGTLICRANG NPKPRISWLT NGVPIEIALD
410 420 430 440 450
DPSRKIDGDT IIFSNVQESS SAVYQCNASN KYGYLLANAF VNVLAEPPRI
460 470 480 490 500
LTSANTLYQV IANRPALLDC AFFGSPMPTI EWFKGTKGSA LHEDIYVLHD
510 520 530 540 550
NGTLEIPVAQ KDSTGTYTCV ARNKLGMAKN EVHLEIKDPT RIIKQPEYAV
560 570 580 590 600
VQRGSKVSFE CRVKHDHTLI PTIMWLKDNG ELPNDERFST DKDHLVVSDV
610 620 630 640 650
KDDDGGTYTC TANTTLDSAS ASAVLRVVAP TPTPAPIYDV PNPPFDLELT
660 670 680 690 700
NQLDKSVQLT WTPGDDNNSP ITKFIIEYED AMHDAGLWRH QAEVSGTQTT
710 720 730 740 750
AQLKLSPYVN YSFRVMAENS IGRSMPSEAS EQYLTKAAEP DQNPMAVEGL
760 770 780 790 800
GTEPDNLVIT WKPLNGFQSN GPGLQYKVSW RQKDGDDEWT SVVVANVSKY
810 820 830 840 850
IVSGTPTFVP YLIKVQALND VGFAPEPAAV MGHSGEDLPM VAPGNVRVSV
860 870 880 890 900
VNSTLAEVHW DPVPPKSVRG HLQGYRIYYW KTQSSSKRNR RHIEKKILTF
910 920 930 940 950
QGTKTHGMLP GLQPYSHYAL NVRVVNGKGE GPASTDRGFH TPEGVPSAPS
960 970 980 990 1000
SLKIVNPTLD SLTLEWDPPS HPNGILTEYI LQYQPINSTH ELGPLVDLKI
1010 1020 1030 1040 1050
PANKTRWTLK NLNFSTRYKF YFYAQTSVGP GSQITEEAIT TVDEAGIPPP
1060 1070 1080 1090 1100
DVGAGKGKEE WRKEIVNGSR SFFGLKGLMP GTAYKVRVGA EGDSGFVSSE
1110 1120 1130 1140 1150
DVFETGPAMA SRQVDIATQG WFIGLMCAVA LLILILLIVC FIRRNKGGKY
1160 1170 1180 1190 1200
PVKEKEDAHA DPEIQPMKED DGTFGEYSDA EDHKPLKKGS RTPSDRTVKK
1210 1220 1230 1240 1250
EDSDDSLVDY GEGVNGQFNE DGSFIGQYSG KKEKEPAEGN ESSEAPSPVN

AMNSFV
Length:1,256
Mass (Da):138,522
Last modified:November 14, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF3F698C2AF3FCFFA
GO
Isoform 2 (identifier: Q810U4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     629-638: Missing.
     1045-1107: AGIPPPDVGAGKGKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGP → GKK

Note: No experimental confirmation available.
Show »
Length:1,186
Mass (Da):131,274
Checksum:i959FBD8D4384F861
GO
Isoform 3 (identifier: Q810U4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1177-1177: Y → YRSFE

Note: No experimental confirmation available.
Show »
Length:1,260
Mass (Da):139,041
Checksum:iD1CF15B186D22420
GO
Isoform 4 (identifier: Q810U4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     254-259: AKSSKE → GELQWL
     260-1256: Missing.

Note: No experimental confirmation available.
Show »
Length:259
Mass (Da):29,063
Checksum:iEB3687E24A1CABED
GO
Isoform 5 (identifier: Q810U4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-35: D → DPKLLHD
     235-254: VDELNDTIAANLSDTEFYGA → GKSSASGLSFNGVYLCGSNY
     255-1256: Missing.

Note: No experimental confirmation available.
Show »
Length:260
Mass (Da):28,964
Checksum:i1794BD3DC8E9A6E2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2P7X4A0A1W2P7X4_MOUSE
Neuronal cell adhesion molecule
Nrcam
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P6Z1A0A1W2P6Z1_MOUSE
Neuronal cell adhesion molecule
Nrcam
168Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P7Y9A0A1W2P7Y9_MOUSE
Neuronal cell adhesion molecule
Nrcam
1,134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P6P3A0A1W2P6P3_MOUSE
Neuronal cell adhesion molecule
Nrcam
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P7R6A0A1W2P7R6_MOUSE
Neuronal cell adhesion molecule
Nrcam
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P8F5A0A1W2P8F5_MOUSE
Neuronal cell adhesion molecule
Nrcam
30Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P814A0A1W2P814_MOUSE
Neuronal cell adhesion molecule
Nrcam
232Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P6F8A0A1W2P6F8_MOUSE
Neuronal cell adhesion molecule
Nrcam
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P6V1A0A1W2P6V1_MOUSE
Neuronal cell adhesion molecule
Nrcam
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC65534 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD65848 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00892135D → DPKLLHD in isoform 5. 1 Publication1
Alternative sequenceiVSP_008922235 – 254VDELN…EFYGA → GKSSASGLSFNGVYLCGSNY in isoform 5. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_008923254 – 259AKSSKE → GELQWL in isoform 4. 1 Publication6
Alternative sequenceiVSP_008924255 – 1256Missing in isoform 5. 1 PublicationAdd BLAST1002
Alternative sequenceiVSP_008925260 – 1256Missing in isoform 4. 1 PublicationAdd BLAST997
Alternative sequenceiVSP_008926629 – 638Missing in isoform 2. 1 Publication10
Alternative sequenceiVSP_0089271045 – 1107AGIPP…FETGP → GKK in isoform 2. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_0089301177Y → YRSFE in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ543321 mRNA Translation: CAD65848.1 Different initiation.
AK122252 mRNA Translation: BAC65534.1 Different initiation.
AK039322 mRNA Translation: BAC30318.1
AK048567 mRNA Translation: BAC33377.1
AK045259 mRNA Translation: BAC32284.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS49056.1 [Q810U4-1]
CCDS49057.1 [Q810U4-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001139503.1, NM_001146031.1 [Q810U4-2]
NP_795904.3, NM_176930.4 [Q810U4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000020939; ENSMUSP00000020939; ENSMUSG00000020598 [Q810U4-1]
ENSMUST00000110748; ENSMUSP00000106376; ENSMUSG00000020598 [Q810U4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
319504

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:319504

UCSC genome browser

More...
UCSCi
uc007nls.2 mouse [Q810U4-5]
uc007nlt.2 mouse [Q810U4-2]
uc007nlu.2 mouse [Q810U4-1]
uc007nlw.1 mouse [Q810U4-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ543321 mRNA Translation: CAD65848.1 Different initiation.
AK122252 mRNA Translation: BAC65534.1 Different initiation.
AK039322 mRNA Translation: BAC30318.1
AK048567 mRNA Translation: BAC33377.1
AK045259 mRNA Translation: BAC32284.1
CCDSiCCDS49056.1 [Q810U4-1]
CCDS49057.1 [Q810U4-2]
RefSeqiNP_001139503.1, NM_001146031.1 [Q810U4-2]
NP_795904.3, NM_176930.4 [Q810U4-1]

3D structure databases

SMRiQ810U4
ModBaseiSearch...

Protein-protein interaction databases

BioGridi235320, 4 interactors
CORUMiQ810U4
IntActiQ810U4, 5 interactors
MINTiQ810U4
STRINGi10090.ENSMUSP00000020939

PTM databases

GlyConnecti2549
iPTMnetiQ810U4
PhosphoSitePlusiQ810U4

Proteomic databases

PaxDbiQ810U4
PeptideAtlasiQ810U4
PRIDEiQ810U4

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q810U4

The DNASU plasmid repository

More...
DNASUi
319504

Genome annotation databases

EnsembliENSMUST00000020939; ENSMUSP00000020939; ENSMUSG00000020598 [Q810U4-1]
ENSMUST00000110748; ENSMUSP00000106376; ENSMUSG00000020598 [Q810U4-2]
GeneIDi319504
KEGGimmu:319504
UCSCiuc007nls.2 mouse [Q810U4-5]
uc007nlt.2 mouse [Q810U4-2]
uc007nlu.2 mouse [Q810U4-1]
uc007nlw.1 mouse [Q810U4-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4897
MGIiMGI:104750 Nrcam

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3513 Eukaryota
ENOG410XSVG LUCA
GeneTreeiENSGT00940000155419
HOGENOMiHOG000231380
InParanoidiQ810U4
KOiK06756
OrthoDBi1318335at2759
PhylomeDBiQ810U4
TreeFamiTF351098

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Nrcam mouse

Protein Ontology

More...
PROi
PR:Q810U4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000020598 Expressed in 221 organ(s), highest expression level in pineal body
ExpressionAtlasiQ810U4 baseline and differential
GenevisibleiQ810U4 MM

Family and domain databases

CDDicd00063 FN3, 4 hits
Gene3Di2.60.40.10, 10 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003006 Ig/MHC_CS
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR026966 Neurofascin/L1/NrCAM_C
PfamiView protein in Pfam
PF13882 Bravo_FIGEY, 1 hit
PF00041 fn3, 4 hits
PF07679 I-set, 2 hits
SMARTiView protein in SMART
SM00060 FN3, 4 hits
SM00409 IG, 6 hits
SM00408 IGc2, 6 hits
SUPFAMiSSF48726 SSF48726, 6 hits
SSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 4 hits
PS50835 IG_LIKE, 6 hits
PS00290 IG_MHC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRCAM_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q810U4
Secondary accession number(s): Q80U33
, Q8BLG8, Q8BX92, Q8BYJ8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: November 14, 2003
Last modified: October 16, 2019
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again