Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (16 Oct 2019)
Sequence version 2 (13 Apr 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium-activated potassium channel subunit alpha-1

Gene

KCNMA1

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by the concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca2+, caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX).1 Publication

Miscellaneous

The protein was initially thought to contain two functionally distinct parts: The core channel (from the N-terminus to the S9 segment) that mediates the channel activity, and the cytoplasmic tail (from the S9 segment to the C-terminus) that mediates the calcium sensing. The situation is however more complex, since the core channel contains binding sites for Ca2+ and Mg2+.

Caution

It is uncertain whether Met-1 is the initiator or if the sequence starts further upstream.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Ethanol and carbon monoxide-bound heme increase channel activation. Heme inhibits channel activation (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi398MagnesiumBy similarity1
Metal bindingi421MagnesiumBy similarity1
Metal bindingi423MagnesiumBy similarity1
Metal bindingi913Calcium; via carbonyl oxygenBy similarity1
Metal bindingi916Calcium; via carbonyl oxygenBy similarity1
Metal bindingi919CalciumBy similarity1
Metal bindingi921CalciumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandCalcium, Magnesium, Metal-binding, Potassium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-GGA-1296052 Ca2+ activated K+ channels

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-activated potassium channel subunit alpha-1
Alternative name(s):
BK channel
BKCA alpha
Calcium-activated potassium channel, subfamily M subunit alpha-1
K(VCA)alpha
KCa1.1
Maxi K channel
Short name:
MaxiK
Slo-alpha
Slo1
Slowpoke homolog
Short name:
Slo homolog
Short name:
cSlo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KCNMA1
Synonyms:KCNMA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiGallus gallus (Chicken)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9031 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000539 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 44ExtracellularSequence analysisAdd BLAST44
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei45 – 65Helical; Name=Segment S0Sequence analysisAdd BLAST21
Topological domaini66 – 137CytoplasmicSequence analysisAdd BLAST72
Transmembranei138 – 158Helical; Name=Segment S1Sequence analysisAdd BLAST21
Topological domaini159 – 173ExtracellularSequence analysisAdd BLAST15
Transmembranei174 – 194Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini195 – 198CytoplasmicSequence analysis4
Transmembranei199 – 219Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini220 – 223ExtracellularSequence analysis4
Transmembranei224 – 244Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST21
Topological domaini245 – 259CytoplasmicSequence analysisAdd BLAST15
Transmembranei260 – 280Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini281 – 294ExtracellularSequence analysisAdd BLAST14
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei295 – 317Pore-forming; Name=P regionSequence analysisAdd BLAST23
Topological domaini318 – 326ExtracellularSequence analysis9
Transmembranei327 – 347Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini348 – 1137CytoplasmicSequence analysisAdd BLAST790

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000541381 – 1137Calcium-activated potassium channel subunit alpha-1Add BLAST1137

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8AYS8

PRoteomics IDEntifications database

More...
PRIDEi
Q8AYS8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8AYS8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8AYS8 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer; which constitutes the calcium-activated potassium channel.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
675104, 110 interactors

Protein interaction database and analysis system

More...
IntActi
Q8AYS8, 106 interactors

Molecular INTeraction database

More...
MINTi
Q8AYS8

STRING: functional protein association networks

More...
STRINGi
9031.ENSGALP00000039705

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8AYS8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini374 – 517RCK N-terminalAdd BLAST144

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni515 – 535Segment S7Add BLAST21
Regioni572 – 592Segment S8Add BLAST21
Regioni636 – 640Heme-binding motif5
Regioni738 – 758Segment S9Add BLAST21
Regioni933 – 953Segment S10Add BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi311 – 314Selectivity for potassium4
Motifi904 – 926Calcium bowlAdd BLAST23

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The S0 segment is essential for the modulation by the accessory beta subunits.By similarity
The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor.By similarity
The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium (By similarity).By similarity
The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel. It includes binding sites for Ca2+ and Mg2+ (By similarity).By similarity
The calcium bowl constitutes one of the Ca2+ sensors and probably acts as a Ca2+-binding site. There are however other Ca2+ sensors regions required for activation of the channel (By similarity).By similarity
The heme-binding motif mediates inhibition of channel activation by heme. Carbon monoxide-bound heme leads to increased channel activation (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1420 Eukaryota
ENOG410YUX1 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154935

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8AYS8

KEGG Orthology (KO)

More...
KOi
K04936

Database of Orthologous Groups

More...
OrthoDBi
124461at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024939 Ca-act_K_channel_Slo-1
IPR005821 Ion_trans_dom
IPR003929 K_chnl_BK_asu
IPR036291 NAD(P)-bd_dom_sf
IPR027359 Volt_channel_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10027:SF28 PTHR10027:SF28, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03493 BK_channel_a, 1 hit
PF00520 Ion_trans, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51735 SSF51735, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 10 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8AYS8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSNNINANNL NTDSSSSPVN VPKMDALIIP VTMEVPCDSR GQRMWWAFLA
60 70 80 90 100
SSMVTFFGGL FIILLWRTLK YLWTVCCHCG VKNKEAQKIN GGGDTQADGA
110 120 130 140 150
CKPTDEKEEN VAAEVGWMTS VKDWAGVMIS AQTLTGRVLV VLVFALSIGA
160 170 180 190 200
LVIYFIDSSN PIESCQNFYK DFTLQIDMAF NVFFLLYFGL RFIAANDKLW
210 220 230 240 250
FWLEVNSVVD FFTVPPVFVS VYLNRSWLGL RFLRALRLIQ FSEILQFLNI
260 270 280 290 300
LKTSNSIKLV NLCSIFISTW LTAAGFIHLV ENSGDPWENF QNNQQLTYWE
310 320 330 340 350
CVYLLMVTMS TVGYGDVYAK TTLGRLFMVF FILGGLAMFA SYVPEIIELI
360 370 380 390 400
GNRKKYGGSY SAVSGRKHIV VCGHITLESV SNFLKDFLHK DRDDVNVEIV
410 420 430 440 450
FLHNISPNLE LEALFKRHFT QVEFYQGSVL NPHDLARVKI ESADACLILA
460 470 480 490 500
NKYCADPDAE DASNIMRVIS IKNYHPKIRI ITQMLQYHNK AHLLNIPSWN
510 520 530 540 550
WKEGDDAICL AELKLGFIAQ SCLAPGLSTM LANLFSMRSF IKIEEDTWQK
560 570 580 590 600
YYLEGVANEM YTEYLSSAFV GLSFPAVCEL VFAKLKLLMI AIEYKSEKRE
610 620 630 640 650
SSILINPGNH VKIQEGTLGF FIASDAKEVK RAFFYCKACH DDITDPKRIK
660 670 680 690 700
KCGCKRLEDE QPSTLSPKKK QRNGGMRNSP NSSPKLMRHD PLLIPGNEQI
710 720 730 740 750
DNMDANVKKY DSTGMFHWCP AKDIEKVILT RSEAAMTVLS GHVVVCIFGD
760 770 780 790 800
VKSALIGLRN LVMPLRASNF HYHELKHIVF VGSLEYLRRE WETLHNFPKV
810 820 830 840 850
SILPGTPLSR ADLRAVNINL CDMCVILSAN QNNIDDASLQ DKECILASLN
860 870 880 890 900
IKSMQFDDSI GVLQANSQGF TPPGMDRSSP DNSPVHGLLR QPSITTGANI
910 920 930 940 950
PIITELVNDS NVQFLDQDDD DDPDTELYLT QPFACGTAFA VSVLDSLMSA
960 970 980 990 1000
TYFNDNILTL IRTLVTGGAT PELEALIAEE NALRGGYSTP QTLANRDRCR
1010 1020 1030 1040 1050
VAQLALYDGP FADLGDGGCY GDLFCKALKT YNMLCFGIYR LRDAHLSTPS
1060 1070 1080 1090 1100
QCTKRYVITN PPYEFELVPT DLIFCLMQFD HNAGQSRASL SHSSHSSYSS
1110 1120 1130
SKKSSSVHSI PSTANRPNRT KTRDSREKQK YVQEDRL
Length:1,137
Mass (Da):127,647
Last modified:April 13, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i40A9735E586F0BD1
GO
Isoform 2 (identifier: Q8AYS8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     602-602: S → RSRKR

Show »
Length:1,141
Mass (Da):128,243
Checksum:i60A2C0EAB0534269
GO
Isoform 3 (identifier: Q8AYS8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     657-657: L → PKMSIYKRMKLACCFDCGRSERDCSCMSGSVHSNMDTLERAFPLSSVSVNDCSTSLRAF

Show »
Length:1,195
Mass (Da):134,076
Checksum:i6AAD8F835A7A8177
GO
Isoform 4 (identifier: Q8AYS8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1130-1137: KYVQEDRL → NSTRMNRMGQEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC

Show »
Length:1,189
Mass (Da):133,667
Checksum:iB334AAB3F4714EED
GO
Isoform 5 (identifier: Q8AYS8-5) [UniParc]FASTAAdd to basket
Also known as: IK

The sequence of this isoform differs from the canonical sequence as follows:
     906-906: L → LAKPGKLLPLVSISQEKNSGTQILMITEL

Show »
Length:1,165
Mass (Da):130,638
Checksum:i905BB9D1B2344E58
GO
Isoform 6 (identifier: Q8AYS8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     657-657: L → IYF

Show »
Length:1,139
Mass (Da):127,957
Checksum:i45822D895211C704
GO
Isoform 7 (identifier: Q8AYS8-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MSNNINANNLNTDSSSS → MKPFEVSLPPPPPS

Show »
Length:1,134
Mass (Da):127,387
Checksum:i40B414AEFE0F1B55
GO
Isoform 8 (identifier: Q8AYS8-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     160-160: N → KSRTADSLI

Show »
Length:1,145
Mass (Da):128,505
Checksum:iC27FD559A611453C
GO
Isoform 9 (identifier: Q8AYS8-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     602-602: S → RSRKRYALFVTFPSNLNPTST

Show »
Length:1,157
Mass (Da):129,997
Checksum:i6284CAE9979B4A00
GO
Isoform 10 (identifier: Q8AYS8-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     687-687: M → MRFSCPFLP

Show »
Length:1,145
Mass (Da):128,595
Checksum:i61A433CB6C95073E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3X739D3X739_CHICK
Calcium-activated potassium channel...
kcnma1 KCNMA1
1,247Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3X740D3X740_CHICK
Calcium-activated potassium channel...
kcnma1 KCNMA1
1,193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3X747D3X747_CHICK
Calcium-activated potassium channel...
kcnma1 KCNMA1
1,140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1RN69A0A1L1RN69_CHICK
Calcium-activated potassium channel...
KCNMA1
1,189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q2UFY3A0A3Q2UFY3_CHICK
Calcium-activated potassium channel...
KCNMA1
1,165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GG29R4GG29_CHICK
Calcium-activated potassium channel...
KCNMA1
1,205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1RKS9A0A1L1RKS9_CHICK
Calcium-activated potassium channel...
KCNMA1
1,197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti96Q → R in AAC60378 (PubMed:9178544).Curated1
Sequence conflicti397V → I in AAC60378 (PubMed:9178544).Curated1
Sequence conflicti409L → P in AAC35370 (PubMed:10362660).Curated1
Sequence conflicti522C → S in AAC60378 (PubMed:9178544).Curated1
Sequence conflicti712S → W in BAC20639 (PubMed:8755483).Curated1
Sequence conflicti937T → P in BAC20639 (PubMed:8755483).Curated1
Sequence conflicti941V → D in BAC20639 (PubMed:8755483).Curated1
Sequence conflicti1034L → F in AAC35370 (PubMed:10362660).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0099831 – 17MSNNI…DSSSS → MKPFEVSLPPPPPS in isoform 7. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_009984160N → KSRTADSLI in isoform 8. 1 Publication1
Alternative sequenceiVSP_009985602S → RSRKR in isoform 2. 1 Publication1
Alternative sequenceiVSP_009986602S → RSRKRYALFVTFPSNLNPTS T in isoform 9. 1 Publication1
Alternative sequenceiVSP_009987657L → PKMSIYKRMKLACCFDCGRS ERDCSCMSGSVHSNMDTLER AFPLSSVSVNDCSTSLRAF in isoform 3. 2 Publications1
Alternative sequenceiVSP_009988657L → IYF in isoform 6. 1 Publication1
Alternative sequenceiVSP_009989687M → MRFSCPFLP in isoform 10. 1 Publication1
Alternative sequenceiVSP_009990906L → LAKPGKLLPLVSISQEKNSG TQILMITEL in isoform 5. 2 Publications1
Alternative sequenceiVSP_0099911130 – 1137KYVQEDRL → NSTRMNRMGQEKKWFTDEPD NAYPRNIQIKPMSTHMANQI NQYKSTSSLIPPIREVEDEC in isoform 4. 1 Publication8

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U23821 mRNA Translation: AAC60378.1
U23823 mRNA Translation: AAC60125.1
U73189 mRNA Translation: AAB17873.1
AF087663 mRNA Translation: AAC35370.1
AB072618 mRNA Translation: BAC20639.1

NCBI Reference Sequences

More...
RefSeqi
NP_989555.1, NM_204224.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSGALT00000007982; ENSGALP00000007968; ENSGALG00000004980 [Q8AYS8-8]
ENSGALT00000040502; ENSGALP00000039705; ENSGALG00000004980 [Q8AYS8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
374065

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
gga:374065

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U23821 mRNA Translation: AAC60378.1
U23823 mRNA Translation: AAC60125.1
U73189 mRNA Translation: AAB17873.1
AF087663 mRNA Translation: AAC35370.1
AB072618 mRNA Translation: BAC20639.1
RefSeqiNP_989555.1, NM_204224.1

3D structure databases

SMRiQ8AYS8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi675104, 110 interactors
IntActiQ8AYS8, 106 interactors
MINTiQ8AYS8
STRINGi9031.ENSGALP00000039705

PTM databases

iPTMnetiQ8AYS8

Proteomic databases

PaxDbiQ8AYS8
PRIDEiQ8AYS8

Genome annotation databases

EnsembliENSGALT00000007982; ENSGALP00000007968; ENSGALG00000004980 [Q8AYS8-8]
ENSGALT00000040502; ENSGALP00000039705; ENSGALG00000004980 [Q8AYS8-1]
GeneIDi374065
KEGGigga:374065

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3778

Phylogenomic databases

eggNOGiKOG1420 Eukaryota
ENOG410YUX1 LUCA
GeneTreeiENSGT00940000154935
InParanoidiQ8AYS8
KOiK04936
OrthoDBi124461at2759

Enzyme and pathway databases

ReactomeiR-GGA-1296052 Ca2+ activated K+ channels

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8AYS8

Gene expression databases

ExpressionAtlasiQ8AYS8 baseline and differential

Family and domain databases

Gene3Di1.20.120.350, 1 hit
InterProiView protein in InterPro
IPR024939 Ca-act_K_channel_Slo-1
IPR005821 Ion_trans_dom
IPR003929 K_chnl_BK_asu
IPR036291 NAD(P)-bd_dom_sf
IPR027359 Volt_channel_dom_sf
PANTHERiPTHR10027:SF28 PTHR10027:SF28, 1 hit
PfamiView protein in Pfam
PF03493 BK_channel_a, 1 hit
PF00520 Ion_trans, 1 hit
SUPFAMiSSF51735 SSF51735, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCMA1_CHICK
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8AYS8
Secondary accession number(s): O12942
, O13110, O93569, Q98951, Q9PS76
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: April 13, 2004
Last modified: October 16, 2019
This is version 137 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again