Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 141 (13 Nov 2019)
Sequence version 3 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ankyrin repeat and sterile alpha motif domain-containing protein 1B

Gene

Anks1b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 2 may participate in the regulation of nucleoplasmic coilin protein interactions in neuronal and transformed cells.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Alternative name(s):
Amyloid-beta protein intracellular domain-associated protein 1
Short name:
AIDA-1
E2A-PBX1-associated protein
Short name:
EB-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Anks1b
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1924781 Anks1b

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Nucleus, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003272601 – 1259Ankyrin repeat and sterile alpha motif domain-containing protein 1BAdd BLAST1259

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei310PhosphoserineCombined sources1
Modified residuei311PhosphoserineCombined sources1
Modified residuei315PhosphoserineCombined sources1
Modified residuei353PhosphoserineCombined sources1
Modified residuei364PhosphoserineBy similarity1
Modified residuei503PhosphothreonineCombined sources1
Modified residuei507PhosphoserineCombined sources1
Modified residuei510PhosphoserineCombined sources1
Modified residuei738PhosphoserineCombined sources1
Modified residuei772PhosphothreonineBy similarity1
Modified residuei774PhosphoserineBy similarity1
Modified residuei900PhosphotyrosineCombined sources1
Modified residuei973PhosphoserineCombined sources1
Modified residuei1006PhosphotyrosineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BIZ1

PeptideAtlas

More...
PeptideAtlasi
Q8BIZ1

PRoteomics IDEntifications database

More...
PRIDEi
Q8BIZ1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BIZ1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BIZ1

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EPHA8.

Isoform 2 interacts with COIL (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
218749, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q8BIZ1, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000138539

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BIZ1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati2 – 31ANK 1Add BLAST30
Repeati58 – 87ANK 2Add BLAST30
Repeati91 – 120ANK 3Add BLAST30
Repeati127 – 156ANK 4Add BLAST30
Repeati160 – 189ANK 5Add BLAST30
Repeati193 – 222ANK 6Add BLAST30
Repeati225 – 254ANK 7Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini809 – 875SAM 1PROSITE-ProRule annotationAdd BLAST67
Domaini883 – 948SAM 2PROSITE-ProRule annotationAdd BLAST66
Domaini1055 – 1212PIDPROSITE-ProRule annotationAdd BLAST158

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi934Nuclear localization signalBy similarity1

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0507 Eukaryota
COG0666 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007214

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BIZ1

KEGG Orthology (KO)

More...
KOi
K21413

Database of Orthologous Groups

More...
OrthoDBi
549581at2759

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09499 SAM_AIDA1AB-like_repeat1, 1 hit
cd09500 SAM_AIDA1AB-like_repeat2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.150.50, 2 hits
1.25.40.20, 2 hits
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033636 ANKS1B
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR041880 SAM_ANKS1_repeat1
IPR041882 SAM_ANKS1_repeat2

The PANTHER Classification System

More...
PANTHERi
PTHR24174:SF3 PTHR24174:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 3 hits
PF00640 PID, 1 hit
PF00536 SAM_1, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415 ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 6 hits
SM00462 PTB, 1 hit
SM00454 SAM, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47769 SSF47769, 2 hits
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 5 hits
PS01179 PID, 1 hit
PS50105 SAM_DOMAIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 25 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BIZ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGKDQELLEA ARTGNVALVE KLLSGRKGGI LGGGSGPLPL SNLLSIWRGP
60 70 80 90 100
NVNCTDSSGY TALHHAALNG HKDIVLKLLQ YEASTNVADN KGYFPIHLAA
110 120 130 140 150
WKGDVEIVKI LIHHGPSHSR VNEQNNENET ALHCAAQYGH SEVVAVLLEE
160 170 180 190 200
LTDPTIRNSK LETPLDLAAL YGRLRVVKMI ISAHPNLMSC NTRKHTPLHL
210 220 230 240 250
AARNGHKAVV QVLLEAGMDV SCQTEKGSAL HEAALFGKVD VVRVLLETGI
260 270 280 290 300
DANIKDSLGR TVLDILKEHP SQKSLQIATL LQDYLEGAGR SAAVLEEHAQ
310 320 330 340 350
EDTAQETHLS SPAESPQKTK SETVTGELSK LLDEIKLCQE KDYSFEDLCH
360 370 380 390 400
TISDHYLDNL SKISEEELGK NGSQSVRTSS TINLSPGEVE DEEEDPNSCG
410 420 430 440 450
PTGLWEALTP CNGCRNLGFP MLAQESYPKK RNFPMEMEPS ASLDTFPSEN
460 470 480 490 500
ENFLCELVDT AVTKKPCSLE IARAPSPRTD NASEVAITAP GTSHHRNSST
510 520 530 540 550
GPTPDCSPPS PDTALKNIVK VIRPQPKQRT SIVSSLDFQR MNHNQEYFEI
560 570 580 590 600
STSTGCTSFT SSPAASPPTS SVETTEVKNE GAEHADDLSQ QEDDEPPKEY
610 620 630 640 650
DAGQFAGLLH GSSPACESPE NPFHLYGKRN TCEDGPDEAS LANSPLPFKQ
660 670 680 690 700
TPIENNPEPS VKKVKPKVVS RTIFHKRNHQ LENHTIVGTR MSRSGSRNGD
710 720 730 740 750
QWGVNPGGFV ERACTLGRIR SLPKALIDMH LSKNVSKSDS DLIAYPSKDK
760 770 780 790 800
ARVNWSKSST AERSSKDNSE RTPSFTSEWE EIDKIMNSID VGINSELEGM
810 820 830 840 850
NGETTRPRCP VQTVGQWLES IGLPQYENHL MANGFDSVQF MGSNVMEDQD
860 870 880 890 900
LLEIGILNSG HRQRILQAIQ LLPKMRPIGH DGYHPTSVAE WLDSIELGDY
910 920 930 940 950
TKAFLINGYT SMDLLKKIWE LELINVLKIS LIGHRKRILA SLGDRLHDDP
960 970 980 990 1000
PQKPPRSITL REPSGNHTPP QLSPSLSQST YTTGGSLDVP HIIMQGDARR
1010 1020 1030 1040 1050
RRNENYFDDI PRSKLERQMA QTGDWGEPSI TLRPPNEATA STPVQYWQHH
1060 1070 1080 1090 1100
PEKLIFQSCD YKAFYLGSML IKELRGTEST QDACAKMRAN CRKSTEQMKK
1110 1120 1130 1140 1150
VPTIILSVSY KGVKFIDAAN KNIIAEHEIR NISCAAQDPE DLSTFAYITK
1160 1170 1180 1190 1200
DLKSNHHYCH VFTAFDVNLA YEIILTLGQA FEVAYQLALQ ARKGGHSSTL
1210 1220 1230 1240 1250
PESFENKPSK PIPKPRVSIR KSVQIDPSEQ KTLANLPWIV EPGQEAKRGI

NTKYETTIF
Length:1,259
Mass (Da):139,047
Last modified:July 27, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i90956D38BF970B1C
GO
Isoform 2 (identifier: Q8BIZ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-773: Missing.
     774-806: SFTSEWEEIDKIMNSIDVGINSELEGMNGETTR → MMWQCHPSAPDYRYYPVDGYSLLKRFPLHPLTG
     962-1021: Missing.

Show »
Length:426
Mass (Da):48,342
Checksum:i5870A4FE4DD6D56E
GO
Isoform 3 (identifier: Q8BIZ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-830: Missing.
     1224-1259: QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF → APQTSCPNRLV

Show »
Length:404
Mass (Da):45,506
Checksum:i32FA628FFD6A3F98
GO
Isoform 4 (identifier: Q8BIZ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-773: Missing.
     774-806: SFTSEWEEIDKIMNSIDVGINSELEGMNGETTR → MMWQCHPSAPDYRYYPVDGYSLLKRFPLHPLTG
     962-1021: EPSGNHTPPQ...RSKLERQMAQ → QSSVCEIWTNQNAGFPFSAIHQVHN

Show »
Length:451
Mass (Da):51,140
Checksum:iF729B371BA91F73A
GO
Isoform 5 (identifier: Q8BIZ1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-993: Missing.

Show »
Length:266
Mass (Da):30,268
Checksum:iAC5EFC1AC4CF8EB5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 25 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R286S4R286_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
1,259Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K4DI73K4DI73_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
932Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R1G5S4R1G5_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
562Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QPP6E9QPP6_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
460Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2I2S4R2I2_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
510Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J2A2A0A0R4J2A2_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
404Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R1Q0S4R1Q0_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
486Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R235S4R235_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
223Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2H2S4R2H2_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
511Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2Q2S4R2Q2_MOUSE
Ankyrin repeat and sterile alpha mo...
Anks1b
509Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1092R → Q in BAC27677 (PubMed:16141072).Curated1
Sequence conflicti1092R → Q in BAC27761 (PubMed:16141072).Curated1
Sequence conflicti1092R → Q in BAC33978 (PubMed:16141072).Curated1
Sequence conflicti1092R → Q in BAE37478 (PubMed:16141072).Curated1
Sequence conflicti1092R → Q in AAH98373 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0327131 – 993Missing in isoform 5. 1 PublicationAdd BLAST993
Alternative sequenceiVSP_0327141 – 830Missing in isoform 3. 1 PublicationAdd BLAST830
Alternative sequenceiVSP_0327151 – 773Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST773
Alternative sequenceiVSP_032716774 – 806SFTSE…GETTR → MMWQCHPSAPDYRYYPVDGY SLLKRFPLHPLTG in isoform 2 and isoform 4. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_032717962 – 1021Missing in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_032718962 – 1021EPSGN…RQMAQ → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 4. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0327191224 – 1259QIDPS…ETTIF → APQTSCPNRLV in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK032061 mRNA Translation: BAC27677.1
AK032211 mRNA Translation: BAC27761.1
AK049899 mRNA Translation: BAC33978.1
AK163750 mRNA Translation: BAE37478.1
AC107661 Genomic DNA No translation available.
AC122212 Genomic DNA No translation available.
AC132093 Genomic DNA No translation available.
AC132131 Genomic DNA No translation available.
AC132328 Genomic DNA No translation available.
AC132465 Genomic DNA No translation available.
AC138719 Genomic DNA No translation available.
AC151984 Genomic DNA No translation available.
AC134539 Genomic DNA No translation available.
BC098373 mRNA Translation: AAH98373.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS59552.1 [Q8BIZ1-4]
CCDS59553.1 [Q8BIZ1-2]
CCDS59554.1 [Q8BIZ1-3]
CCDS83746.1 [Q8BIZ1-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001170868.1, NM_001177397.1
NP_001170869.1, NM_001177398.1
NP_001333982.1, NM_001347053.1
NP_001333983.1, NM_001347054.1
NP_852063.1, NM_181398.3

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
77531

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:77531

UCSC genome browser

More...
UCSCi
uc033fry.1 mouse [Q8BIZ1-4]
uc033frz.1 mouse [Q8BIZ1-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032061 mRNA Translation: BAC27677.1
AK032211 mRNA Translation: BAC27761.1
AK049899 mRNA Translation: BAC33978.1
AK163750 mRNA Translation: BAE37478.1
AC107661 Genomic DNA No translation available.
AC122212 Genomic DNA No translation available.
AC132093 Genomic DNA No translation available.
AC132131 Genomic DNA No translation available.
AC132328 Genomic DNA No translation available.
AC132465 Genomic DNA No translation available.
AC138719 Genomic DNA No translation available.
AC151984 Genomic DNA No translation available.
AC134539 Genomic DNA No translation available.
BC098373 mRNA Translation: AAH98373.1
CCDSiCCDS59552.1 [Q8BIZ1-4]
CCDS59553.1 [Q8BIZ1-2]
CCDS59554.1 [Q8BIZ1-3]
CCDS83746.1 [Q8BIZ1-5]
RefSeqiNP_001170868.1, NM_001177397.1
NP_001170869.1, NM_001177398.1
NP_001333982.1, NM_001347053.1
NP_001333983.1, NM_001347054.1
NP_852063.1, NM_181398.3

3D structure databases

SMRiQ8BIZ1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi218749, 4 interactors
IntActiQ8BIZ1, 4 interactors
STRINGi10090.ENSMUSP00000138539

PTM databases

iPTMnetiQ8BIZ1
PhosphoSitePlusiQ8BIZ1

Proteomic databases

PaxDbiQ8BIZ1
PeptideAtlasiQ8BIZ1
PRIDEiQ8BIZ1

Genome annotation databases

GeneIDi77531
KEGGimmu:77531
UCSCiuc033fry.1 mouse [Q8BIZ1-4]
uc033frz.1 mouse [Q8BIZ1-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56899
MGIiMGI:1924781 Anks1b

Phylogenomic databases

eggNOGiKOG0507 Eukaryota
COG0666 LUCA
HOGENOMiHOG000007214
InParanoidiQ8BIZ1
KOiK21413
OrthoDBi549581at2759

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Anks1b mouse

Protein Ontology

More...
PROi
PR:Q8BIZ1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

CDDicd09499 SAM_AIDA1AB-like_repeat1, 1 hit
cd09500 SAM_AIDA1AB-like_repeat2, 1 hit
Gene3Di1.10.150.50, 2 hits
1.25.40.20, 2 hits
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR033636 ANKS1B
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR041880 SAM_ANKS1_repeat1
IPR041882 SAM_ANKS1_repeat2
PANTHERiPTHR24174:SF3 PTHR24174:SF3, 1 hit
PfamiView protein in Pfam
PF12796 Ank_2, 3 hits
PF00640 PID, 1 hit
PF00536 SAM_1, 2 hits
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SM00462 PTB, 1 hit
SM00454 SAM, 2 hits
SUPFAMiSSF47769 SSF47769, 2 hits
SSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 5 hits
PS01179 PID, 1 hit
PS50105 SAM_DOMAIN, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANS1B_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BIZ1
Secondary accession number(s): E9Q644
, Q4KMR9, Q8BJ47, Q8BJ49
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: July 27, 2011
Last modified: November 13, 2019
This is version 141 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again