Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8CAQ8 (MIC60_MOUSE)

Entry version 135 (13 Nov 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

MICOS complex subunit Mic60

Gene

Immt

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays an important role in the maintenance of the MICOS complex stability and the mitochondrial cristae morphology.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
MICOS complex subunit Mic60
Alternative name(s):
Mitochondrial inner membrane protein
Mitofilin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Immt
Synonyms:Mic60
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1923864 Immt

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini34 – 45Mitochondrial matrixSequence analysisAdd BLAST12
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei46 – 65HelicalSequence analysisAdd BLAST20
Topological domaini66 – 757Mitochondrial intermembraneSequence analysisAdd BLAST692

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 33MitochondrionSequence analysisAdd BLAST33
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000008418534 – 757MICOS complex subunit Mic60Add BLAST724

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei112PhosphoserineBy similarity1
Modified residuei113PhosphoserineBy similarity1
Modified residuei210N6-acetyllysineBy similarity1
Modified residuei221N6-acetyllysineBy similarity1
Modified residuei222PhosphoserineBy similarity1
Modified residuei387PhosphoserineBy similarity1
Modified residuei389PhosphoserineBy similarity1
Modified residuei450N6-acetyllysineBy similarity1
Modified residuei506PhosphotyrosineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8CAQ8

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8CAQ8

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8CAQ8

PeptideAtlas

More...PeptideAtlasi		Q8CAQ8

PRoteomics IDEntifications database

More...PRIDEi		Q8CAQ8

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		Q8CAQ8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8CAQ8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8CAQ8

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8CAQ8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000052337 Expressed in 291 organ(s), highest expression level in muscle tissue

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8CAQ8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8CAQ8 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the mitochondrial contact site and cristae organizing system (MICOS) complex, composed of at least MICOS10/MIC10, CHCHD3/MIC19, CHCHD6/MIC25, APOOL/MIC27, IMMT/MIC60, APOO/MIC23/MIC26 and MICOS13/MIC13. This complex was also known under the names MINOS or MitOS complex. The MICOS complex associates with mitochondrial outer membrane proteins SAMM50, MTX1 and MTX2 (together described as components of the mitochondrial outer membrane sorting assembly machinery (SAM) complex) and DNAJC11, mitochondrial inner membrane protein TMEM11 and with HSPA9. The MICOS and SAM complexes together with DNAJC11 are part of a large protein complex spanning both membranes termed the mitochondrial intermembrane space bridging (MIB) complex.

Interacts with MICOS13/MIC13, MICOS10/MIC10, CHCHD3/MIC19, CHCHD6/MIC25, SAMM50 and TMEM11.

Interacts with APOO/MIC23/MIC26 and APOOL/MIC27 (By similarity).

Interacts with HSPA1A/HSPA1B and OPA1, preferentially with the soluble OPA1 form.

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		218208, 32 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8CAQ8

Database of interacting proteins

More...DIPi		DIP-32050N

Protein interaction database and analysis system

More...IntActi		Q8CAQ8, 42 interactors

Molecular INTeraction database

More...MINTi		Q8CAQ8

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000066181

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8CAQ8

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili199 – 231Sequence analysisAdd BLAST33
Coiled coili279 – 317Sequence analysisAdd BLAST39
Coiled coili397 – 442Sequence analysisAdd BLAST46

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MICOS complex subunit Mic60 family.Curated

Keywords - Domaini

Coiled coil, Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1854 Eukaryota
ENOG410Y49V LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000002313

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8CAQ8

KEGG Orthology (KO)

More...KOi		K17785

Identification of Orthologs from Complete Genome Data

More...OMAi		QARNYFI

Database of Orthologous Groups

More...OrthoDBi		1073064at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8CAQ8

TreeFam database of animal gene trees

More...TreeFami		TF312832

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR019133 Mt-IM_prot_Mitofilin

The PANTHER Classification System

More...PANTHERi		PTHR15415 PTHR15415, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF09731 Mitofilin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8CAQ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLRACQLSGV TVAAQSCLCG KFVLRPLRPC RRYSTSSSSG LTAGKIAGAG 
        60         70         80         90        100
LLFVGGGIGG TILYAKWDSH FRESVEKTIP YSDKLFGMVL GSAPYTVPLP 
       110        120        130        140        150
KKPVQSGPLK ISSVSEVMKD SKLPVAQSQK TKGDTPASAA STGAAQIISA 
       160        170        180        190        200
AGDTLSVPAP AVQHEDTIKT ECPNTNEGKS TSETTEEAFS SSVRERPPEE 
       210        220        230        240        250
VAARLAQQEK QEQVEMESLA KSLEDALNRT SSVTLQTITA QNAAVQAVKA 
       260        270        280        290        300
HSNILKTAMD NSEIAGEKKS AQWRTVEGAL KERRKAVDEA ADALLKAKEE 
       310        320        330        340        350
LEKMKTIIED AKKREIAGAT PHITAAEGRL HNMIVDLDNV VKKVQAAQSE 
       360        370        380        390        400
AKVVSQYHEL VVQARDDFRK ELDSITPDIT PGWKGMSISD LAGKLSTDDL 
       410        420        430        440        450
NSLIAHAHRR IDQLNRELAQ QKATEKQHIE LALEKHKLEE KRTFDSAVAK 
       460        470        480        490        500
ALEHHRSEIQ AEQDRKVEEV RDAMENEMRT QLRRQAAAHT DHLRDVLKVQ 
       510        520        530        540        550
EQELKYEFEQ GLSEKLSEQE LEFRRRSQEQ MDSFTLDINT AYARLRGIEQ 
       560        570        580        590        600
AVQSHAVAEE EARKAHQLWL SVEALKYSMK TSSAEMPTIP LGSAVEAIRV 
       610        620        630        640        650
NCSDNEFTQA LTAAIPPESL TRGVYSEETL RARFYAVQKL ARRVAMIDET 
       660        670        680        690        700
RNSLYQYFLS YLQSLLLFPP KQLKPPAELY PEDINTFKLL SYASYCIEHG 
       710        720        730        740        750
DLELAAKFVN QLKGESRRVA QDWLKEARMT LETKQIVEIL TAYASAVGIG 

TTQVQQE
Length:757
Mass (Da):83,900
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5EB37BCA054BD7A6
GO
Isoform 2 (identifier: Q8CAQ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-151: Missing.

Show »
Length:746
Mass (Da):82,929
Checksum:iD7163AC815B9D0D0
GO
Isoform 3 (identifier: Q8CAQ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-151: Missing.
     186-218: EEAFSSSVRERPPEEVAARLAQQEKQEQVEMES → A
     387-392: SISDLA → T

Note: No experimental confirmation available.
Show »
Length:709
Mass (Da):78,727
Checksum:iE5E8EC4154F1853D
GO
Isoform 4 (identifier: Q8CAQ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-151: Missing.
     186-194: EEAFSSSVR → GSLIIYIML
     195-757: Missing.

Note: May be due to intron retention. No experimental confirmation available.
Show »
Length:183
Mass (Da):19,194
Checksum:i67A485D7DF8DA8D4
GO
Isoform 5 (identifier: Q8CAQ8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     757-757: E → FWIKAVFKSQMSNPTSFKVTRLNSVQKNRSSPLI

Note: No experimental confirmation available.
Show »
Length:790
Mass (Da):87,694
Checksum:i85B4294F1E2C734E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RP81A0A0U1RP81_MOUSE
MICOS complex subunit MIC60
Immt
488Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PVS5E9PVS5_MOUSE
MICOS complex subunit MIC60
Immt
188Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q800E9Q800_MOUSE
MICOS complex subunit MIC60
Immt
679Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QAY6E9QAY6_MOUSE
MICOS complex subunit MIC60
Immt
470Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQ14A0A0U1RQ14_MOUSE
MICOS complex subunit MIC60
Immt
289Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GX08A0A1B0GX08_MOUSE
MICOS complex subunit MIC60
Immt
264Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RNN9A0A0U1RNN9_MOUSE
MICOS complex subunit Mic60
Immt
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB24817 differs from that shown. Reason: Frameshift.Curated
The sequence BAB24817 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti532D → E in BAB24817 (PubMed:16141072).Curated1
Sequence conflicti658F → L in BAB24817 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_007003141 – 151Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_007004186 – 218EEAFS…VEMES → A in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_013222186 – 194EEAFSSSVR → GSLIIYIML in isoform 4. 1 Publication9
Alternative sequenceiVSP_013223195 – 757Missing in isoform 4. 1 PublicationAdd BLAST563
Alternative sequenceiVSP_007005387 – 392SISDLA → T in isoform 3. 1 Publication6
Alternative sequenceiVSP_013224757E → FWIKAVFKSQMSNPTSFKVT RLNSVQKNRSSPLI in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK006977 mRNA Translation: BAB24817.1 Sequence problems.
AK030841 mRNA Translation: BAC27154.1
AK033126 mRNA Translation: BAC28163.1
AK038129 mRNA Translation: BAC29936.1
AK049189 mRNA Translation: BAC33599.1
BC055840 mRNA Translation: AAH55840.1
BC080790 mRNA Translation: AAH80790.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS39509.1 [Q8CAQ8-1]
CCDS57425.1 [Q8CAQ8-2]
CCDS57426.1 [Q8CAQ8-3]

NCBI Reference Sequences

More...RefSeqi		NP_001240610.1, NM_001253681.1 [Q8CAQ8-2]
NP_001240616.1, NM_001253687.1 [Q8CAQ8-3]
NP_001240617.1, NM_001253688.1
NP_083949.2, NM_029673.3 [Q8CAQ8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000064062; ENSMUSP00000066181; ENSMUSG00000052337 [Q8CAQ8-1]
ENSMUST00000101301; ENSMUSP00000098859; ENSMUSG00000052337 [Q8CAQ8-2]
ENSMUST00000114151; ENSMUSP00000109788; ENSMUSG00000052337 [Q8CAQ8-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		76614

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:76614

UCSC genome browser

More...UCSCi		uc009che.2 mouse [Q8CAQ8-4]
uc009chi.2 mouse [Q8CAQ8-1]
uc009chj.2 mouse [Q8CAQ8-2]
uc009chm.2 mouse [Q8CAQ8-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006977 mRNA Translation: BAB24817.1 Sequence problems.
AK030841 mRNA Translation: BAC27154.1
AK033126 mRNA Translation: BAC28163.1
AK038129 mRNA Translation: BAC29936.1
AK049189 mRNA Translation: BAC33599.1
BC055840 mRNA Translation: AAH55840.1
BC080790 mRNA Translation: AAH80790.1
CCDSiCCDS39509.1 [Q8CAQ8-1]
CCDS57425.1 [Q8CAQ8-2]
CCDS57426.1 [Q8CAQ8-3]
RefSeqiNP_001240610.1, NM_001253681.1 [Q8CAQ8-2]
NP_001240616.1, NM_001253687.1 [Q8CAQ8-3]
NP_001240617.1, NM_001253688.1
NP_083949.2, NM_029673.3 [Q8CAQ8-1]

3D structure databases

SMRiQ8CAQ8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi218208, 32 interactors
CORUMiQ8CAQ8
DIPiDIP-32050N
IntActiQ8CAQ8, 42 interactors
MINTiQ8CAQ8
STRINGi10090.ENSMUSP00000066181

PTM databases

iPTMnetiQ8CAQ8
PhosphoSitePlusiQ8CAQ8
SwissPalmiQ8CAQ8

2D gel databases

REPRODUCTION-2DPAGEiQ8CAQ8

Proteomic databases

EPDiQ8CAQ8
jPOSTiQ8CAQ8
PaxDbiQ8CAQ8
PeptideAtlasiQ8CAQ8
PRIDEiQ8CAQ8

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		76614

Genome annotation databases

EnsembliENSMUST00000064062; ENSMUSP00000066181; ENSMUSG00000052337 [Q8CAQ8-1]
ENSMUST00000101301; ENSMUSP00000098859; ENSMUSG00000052337 [Q8CAQ8-2]
ENSMUST00000114151; ENSMUSP00000109788; ENSMUSG00000052337 [Q8CAQ8-3]
GeneIDi76614
KEGGimmu:76614
UCSCiuc009che.2 mouse [Q8CAQ8-4]
uc009chi.2 mouse [Q8CAQ8-1]
uc009chj.2 mouse [Q8CAQ8-2]
uc009chm.2 mouse [Q8CAQ8-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10989
MGIiMGI:1923864 Immt

Phylogenomic databases

eggNOGiKOG1854 Eukaryota
ENOG410Y49V LUCA
GeneTreeiENSGT00390000002313
InParanoidiQ8CAQ8
KOiK17785
OMAiQARNYFI
OrthoDBi1073064at2759
PhylomeDBiQ8CAQ8
TreeFamiTF312832

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Immt mouse

Protein Ontology

More...PROi		PR:Q8CAQ8

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000052337 Expressed in 291 organ(s), highest expression level in muscle tissue
ExpressionAtlasiQ8CAQ8 baseline and differential
GenevisibleiQ8CAQ8 MM

Family and domain databases

InterProiView protein in InterPro
IPR019133 Mt-IM_prot_Mitofilin
PANTHERiPTHR15415 PTHR15415, 1 hit
PfamiView protein in Pfam
PF09731 Mitofilin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMIC60_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CAQ8
Secondary accession number(s): Q66JS4
, Q7TNE2, Q8C7V1, Q8CCI0, Q8CDA8, Q9D9F6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: March 1, 2003
Last modified: November 13, 2019
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again