Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (18 Sep 2019)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nostrin

Gene

NOSTRIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Multivalent adapter protein which may decrease NOS3 activity by inducing its translocation away from the plasma membrane.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processEndocytosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-203641 NOSTRIN mediated eNOS trafficking

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nostrin
Alternative name(s):
BM247 homolog
Nitric oxide synthase traffic inducer
Nitric oxide synthase trafficker
eNOS-trafficking inducer
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NOSTRIN
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20203 NOSTRIN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607496 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IVI9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
115677

Open Targets

More...
OpenTargetsi
ENSG00000163072

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134992787

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8IVI9

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NOSTRIN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373401

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002890891 – 506NostrinAdd BLAST506

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei114PhosphoserineBy similarity1
Modified residuei479PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8IVI9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8IVI9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IVI9

PeptideAtlas

More...
PeptideAtlasi
Q8IVI9

PRoteomics IDEntifications database

More...
PRIDEi
Q8IVI9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
17440
70712 [Q8IVI9-1]
70713 [Q8IVI9-2]
70714 [Q8IVI9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IVI9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IVI9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at highest levels in heart, kidney, placenta and lung, and at lowest levels in brain, thymus and spleen. Present in vascular endothelial cells and placenta. Over-expressed in placenta from women with pre-eclampsia (at protein level).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163072 Expressed in 149 organ(s), highest expression level in right lung

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IVI9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IVI9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA044384

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer.

Interacts with DAB2 (By similarity).

Interacts with NOS3, DNM2, WASL and CAV1.

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125446, 4 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8IVI9

Protein interaction database and analysis system

More...
IntActi
Q8IVI9, 15 interactors

Molecular INTeraction database

More...
MINTi
Q8IVI9

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1506
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IVI9

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8IVI9

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 260F-BARPROSITE-ProRule annotationAdd BLAST260
Domaini292 – 372REM-1PROSITE-ProRule annotationAdd BLAST81
Domaini438 – 497SH3PROSITE-ProRule annotationAdd BLAST60

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili160 – 222Sequence analysisAdd BLAST63

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SH3 domain mediates interaction with NOS3, DNM2 and WASL.
The F-BAR domain is necessary for membrane targeting.

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000048120

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113830

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IVI9

KEGG Orthology (KO)

More...
KOi
K20126

Identification of Orthologs from Complete Genome Data

More...
OMAi
LAHCQTA

Database of Orthologous Groups

More...
OrthoDBi
445432at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IVI9

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11823 SH3_Nostrin, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1270.60, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR031160 F_BAR
IPR001060 FCH_dom
IPR036274 HR1_rpt_sf
IPR028535 Nostrin
IPR035656 Nostrin_SH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

The PANTHER Classification System

More...
PANTHERi
PTHR14167:SF31 PTHR14167:SF31, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00611 FCH, 1 hit
PF14604 SH3_9, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103657 SSF103657, 1 hit
SSF46585 SSF46585, 1 hit
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51741 F_BAR, 1 hit
PS51860 REM_1, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IVI9-1) [UniParc]FASTAAdd to basket
Also known as: NOSTRINalpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRDPLTDCPY NKVYKNLKEF SQNGENFCKQ VTSVLQQRAN LEISYAKGLQ
60 70 80 90 100
KLASKLSKAL QNTRKSCVSS AWAWASEGMK STADLHQKLG KAIELEAIKP
110 120 130 140 150
TYQVLNVQEK KRKSLDNEVE KTANLVISNW NQQIKAKKKL MVSTKKHEAL
160 170 180 190 200
FQLVESSKQS MTEKEKRKLL NKLTKSTEKL EKEDENYYQK NMAGYSTRLK
210 220 230 240 250
WENTLENCYQ SILELEKERI QLLCNNLNQY SQHISLFGQT LTTCHTQIHC
260 270 280 290 300
AISKIDIEKD IQAVMEETAI LSTENKSEFL LTDYFEEDPN SAMDKERRKS
310 320 330 340 350
LLKPKLLRLQ RDIEKASKDK EGLERMLKTY SSTSSFSDAK SQKDTAALMD
360 370 380 390 400
ENNLKLDLLE ANSYKLSSML AELEQRPQPS HPCSNSIFRW REKEHTHSYV
410 420 430 440 450
KISRPFLMKR LENIVSKASS GGQSNPGSST PAPGAAQLSS RLCKALYSFQ
460 470 480 490 500
ARQDDELNLE KGDIVIIHEK KEGGWWFGSL NGKKGHFPAA YVEELPSNAG

NTATKA
Length:506
Mass (Da):57,660
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDC9A6DF5B9C2AED0
GO
Isoform 2 (identifier: Q8IVI9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     38-65: Missing.

Show »
Length:478
Mass (Da):54,547
Checksum:iE8E6E3B37569F432
GO
Isoform 3 (identifier: Q8IVI9-3) [UniParc]FASTAAdd to basket
Also known as: NOSTRINbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.

Note: May negatively regulate transcription of the NOSTRIN gene.1 Publication
Show »
Length:428
Mass (Da):48,876
Checksum:i8819706D71DAC60C
GO
Isoform 4 (identifier: Q8IVI9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     209-209: Y → YQVTHSICLYAFWVKRAWGKCVSDLRYQDTFLPGNLPPLWFGYDIVKRLIMRLCSVCL

Note: No experimental confirmation available.Curated
Show »
Length:563
Mass (Da):64,364
Checksum:i6FE667B285DD4D54
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PDM0E9PDM0_HUMAN
Nostrin
NOSTRIN
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JPW3A0A0G2JPW3_HUMAN
Nostrin
NOSTRIN
449Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JM79A0A0G2JM79_HUMAN
Nostrin
NOSTRIN
392Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JNL9A0A0G2JNL9_HUMAN
Nostrin
NOSTRIN
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZA6H7BZA6_HUMAN
Nostrin
NOSTRIN
20Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCW8F8WCW8_HUMAN
Nostrin
NOSTRIN
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti225N → D in BAG52717 (PubMed:14702039).Curated1
Isoform 4 (identifier: Q8IVI9-4)
Sequence conflicti238T → I in BAG52717 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032569473G → E4 PublicationsCorresponds to variant dbSNP:rs479661Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0258841 – 78Missing in isoform 3. 1 PublicationAdd BLAST78
Alternative sequenceiVSP_02588538 – 65Missing in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_044995209Y → YQVTHSICLYAFWVKRAWGK CVSDLRYQDTFLPGNLPPLW FGYDIVKRLIMRLCSVCL in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ532842 mRNA Translation: CAD58724.1
DQ402497 mRNA Translation: ABD62889.1
AK002203 mRNA Translation: BAE46614.1
AK093444 mRNA Translation: BAG52717.1
AK290254 mRNA Translation: BAF82943.1
AC069137 Genomic DNA Translation: AAY24097.1
AC009475 Genomic DNA No translation available.
BC014189 mRNA Translation: AAH14189.1
BC093072 mRNA Translation: AAH93072.1
AL550371 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42771.1 [Q8IVI9-1]
CCDS42772.1 [Q8IVI9-3]
CCDS54415.1 [Q8IVI9-4]
CCDS54416.1 [Q8IVI9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001034813.2, NM_001039724.3 [Q8IVI9-1]
NP_001165102.1, NM_001171631.1 [Q8IVI9-4]
NP_001165103.1, NM_001171632.1 [Q8IVI9-2]
NP_443178.2, NM_052946.3 [Q8IVI9-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000317647; ENSP00000318921; ENSG00000163072 [Q8IVI9-1]
ENST00000397206; ENSP00000380390; ENSG00000163072 [Q8IVI9-3]
ENST00000397209; ENSP00000380392; ENSG00000163072 [Q8IVI9-2]
ENST00000444448; ENSP00000394051; ENSG00000163072 [Q8IVI9-4]
ENST00000445023; ENSP00000404413; ENSG00000163072 [Q8IVI9-3]
ENST00000458381; ENSP00000402140; ENSG00000163072 [Q8IVI9-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
115677

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:115677

UCSC genome browser

More...
UCSCi
uc002uef.4 human [Q8IVI9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ532842 mRNA Translation: CAD58724.1
DQ402497 mRNA Translation: ABD62889.1
AK002203 mRNA Translation: BAE46614.1
AK093444 mRNA Translation: BAG52717.1
AK290254 mRNA Translation: BAF82943.1
AC069137 Genomic DNA Translation: AAY24097.1
AC009475 Genomic DNA No translation available.
BC014189 mRNA Translation: AAH14189.1
BC093072 mRNA Translation: AAH93072.1
AL550371 mRNA No translation available.
CCDSiCCDS42771.1 [Q8IVI9-1]
CCDS42772.1 [Q8IVI9-3]
CCDS54415.1 [Q8IVI9-4]
CCDS54416.1 [Q8IVI9-2]
RefSeqiNP_001034813.2, NM_001039724.3 [Q8IVI9-1]
NP_001165102.1, NM_001171631.1 [Q8IVI9-4]
NP_001165103.1, NM_001171632.1 [Q8IVI9-2]
NP_443178.2, NM_052946.3 [Q8IVI9-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YUNNMR-A441-506[»]
SMRiQ8IVI9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi125446, 4 interactors
CORUMiQ8IVI9
IntActiQ8IVI9, 15 interactors
MINTiQ8IVI9

PTM databases

iPTMnetiQ8IVI9
PhosphoSitePlusiQ8IVI9

Polymorphism and mutation databases

BioMutaiNOSTRIN
DMDMi317373401

Proteomic databases

jPOSTiQ8IVI9
MassIVEiQ8IVI9
MaxQBiQ8IVI9
PeptideAtlasiQ8IVI9
PRIDEiQ8IVI9
ProteomicsDBi17440
70712 [Q8IVI9-1]
70713 [Q8IVI9-2]
70714 [Q8IVI9-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
115677

Genome annotation databases

EnsembliENST00000317647; ENSP00000318921; ENSG00000163072 [Q8IVI9-1]
ENST00000397206; ENSP00000380390; ENSG00000163072 [Q8IVI9-3]
ENST00000397209; ENSP00000380392; ENSG00000163072 [Q8IVI9-2]
ENST00000444448; ENSP00000394051; ENSG00000163072 [Q8IVI9-4]
ENST00000445023; ENSP00000404413; ENSG00000163072 [Q8IVI9-3]
ENST00000458381; ENSP00000402140; ENSG00000163072 [Q8IVI9-4]
GeneIDi115677
KEGGihsa:115677
UCSCiuc002uef.4 human [Q8IVI9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
115677
DisGeNETi115677

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NOSTRIN
HGNCiHGNC:20203 NOSTRIN
HPAiHPA044384
MIMi607496 gene
neXtProtiNX_Q8IVI9
OpenTargetsiENSG00000163072
PharmGKBiPA134992787

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00510000048120
HOGENOMiHOG000113830
InParanoidiQ8IVI9
KOiK20126
OMAiLAHCQTA
OrthoDBi445432at2759
PhylomeDBiQ8IVI9

Enzyme and pathway databases

ReactomeiR-HSA-203641 NOSTRIN mediated eNOS trafficking

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NOSTRIN human
EvolutionaryTraceiQ8IVI9

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
115677
PharosiQ8IVI9

Protein Ontology

More...
PROi
PR:Q8IVI9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000163072 Expressed in 149 organ(s), highest expression level in right lung
ExpressionAtlasiQ8IVI9 baseline and differential
GenevisibleiQ8IVI9 HS

Family and domain databases

CDDicd11823 SH3_Nostrin, 1 hit
Gene3Di1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR031160 F_BAR
IPR001060 FCH_dom
IPR036274 HR1_rpt_sf
IPR028535 Nostrin
IPR035656 Nostrin_SH3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR14167:SF31 PTHR14167:SF31, 1 hit
PfamiView protein in Pfam
PF00611 FCH, 1 hit
PF14604 SH3_9, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF46585 SSF46585, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS51741 F_BAR, 1 hit
PS51860 REM_1, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNOSTN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IVI9
Secondary accession number(s): A8K2I9
, B3KSF5, E7EPT9, Q27HG3, Q53S62, Q96CJ9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: January 11, 2011
Last modified: September 18, 2019
This is version 154 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again