Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (31 Jul 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein FAM9B

Gene

FAM9B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q8IZU0 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM9B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM9B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18404 FAM9B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300478 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IZU0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000177138

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27993

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM9B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
29336758

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001190331 – 186Protein FAM9BAdd BLAST186

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8IZU0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IZU0

PeptideAtlas

More...
PeptideAtlasi
Q8IZU0

PRoteomics IDEntifications database

More...
PRIDEi
Q8IZU0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
71428 [Q8IZU0-1]
72351

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed exclusively in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000177138 Expressed in 45 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IZU0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IZU0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035135

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q9H6143EBI-10175124,EBI-10249899
ABT1Q9ULW33EBI-10175124,EBI-2602396
ANKRD36BQ8N2N93EBI-10175124,EBI-2876112
AP1M1Q9BXS53EBI-10175124,EBI-541426
ASB6Q9NWX53EBI-10175124,EBI-6425205
ATF7P175443EBI-10175124,EBI-765623
AURKAIP1Q9NWT83EBI-10175124,EBI-448665
BAG6P463793EBI-10175124,EBI-347552
BARD1Q997283EBI-10175124,EBI-473181
BCL2A1Q165483EBI-10175124,EBI-1003550
BET1Q53XK03EBI-10175124,EBI-10242927
BLOC1S2Q6QNY13EBI-10175124,EBI-465872
BYSLQ138955EBI-10175124,EBI-358049
C12orf10Q86UA33EBI-10175124,EBI-10258793
C16orf72Q14CZ04EBI-10175124,EBI-10234807
C19orf57Q0VDD73EBI-10175124,EBI-741210
C8orf33Q9H7E93EBI-10175124,EBI-715389
CADPSQ9ULU8-43EBI-10175124,EBI-10180690
CCDC106Q9BWC95EBI-10175124,EBI-711501
CCDC116Q8IYX33EBI-10175124,EBI-744311
CCDC198Q9NVL83EBI-10175124,EBI-10238351
CCDC70Q6NSX13EBI-10175124,EBI-6873045
CDC23Q9UJX23EBI-10175124,EBI-396137
CDC42EP4Q9H3Q13EBI-10175124,EBI-744665
CDCA7LQ96GN53EBI-10175124,EBI-5278764
CENPLQ8N0S63EBI-10175124,EBI-8467109
CEP57L1Q8IYX8-23EBI-10175124,EBI-10181988
CEP95Q96GE43EBI-10175124,EBI-372775
CHRAC1Q9NRG05EBI-10175124,EBI-2795492
CLCN1P355233EBI-10175124,EBI-10206780
COL20A1Q9P218-23EBI-10175124,EBI-10318410
CSDE1O755343EBI-10175124,EBI-719186
CWF19L2Q2TBE03EBI-10175124,EBI-5453285
DAPK2Q9UIK43EBI-10175124,EBI-77154
DAXXQ9UER73EBI-10175124,EBI-77321
DENND2DQ9H6A03EBI-10175124,EBI-10307465
DGUOKA0A0S2Z3T74EBI-10175124,EBI-16436767
DNAJC15Q9Y5T43EBI-10175124,EBI-10329228
DNAJC4Q96FY53EBI-10175124,EBI-10286235
EBNA1BP2Q6IB293EBI-10175124,EBI-10249955
ECH1Q130113EBI-10175124,EBI-711968
EIF3GO758213EBI-10175124,EBI-366632
ELOAQ142413EBI-10175124,EBI-742350
FAM161AQ3B8203EBI-10175124,EBI-719941
FASTKD3Q14CZ73EBI-10175124,EBI-10234819
FCHSD2O948683EBI-10175124,EBI-1215612
FERD3LQ96RJ63EBI-10175124,EBI-10183007
FNDC11Q9BVV23EBI-10175124,EBI-744935
GFOD1Q9NXC23EBI-10175124,EBI-8799578
GSTK1Q9Y2Q33EBI-10175124,EBI-1053767
ISCUQ9H1K13EBI-10175124,EBI-1047335
LIN7AO149103EBI-10175124,EBI-2513988
LNX1Q8TBB13EBI-10175124,EBI-739832
LYRM2Q9NU233EBI-10175124,EBI-10313813
MAB21L3Q8N8X93EBI-10175124,EBI-10268010
MFAP1P550813EBI-10175124,EBI-1048159
MGC24125Q8NEQ23EBI-10175124,EBI-10270788
MOB1AQ9H8S93EBI-10175124,EBI-748229
MORF4L1Q9UBU83EBI-10175124,EBI-399246
MORF4L2Q150143EBI-10175124,EBI-399257
MRPL10Q7Z7H83EBI-10175124,EBI-723524
MRPL28Q130843EBI-10175124,EBI-723426
MRPL9Q9BYD23EBI-10175124,EBI-726059
NDUFB10O960005EBI-10175124,EBI-1246371
NEBLO760413EBI-10175124,EBI-2880203
NOL4O94818-23EBI-10175124,EBI-10190763
PAGE1O754593EBI-10175124,EBI-2559100
PAGE3Q5JUK93EBI-10175124,EBI-10244544
PHYHO148326EBI-10175124,EBI-721853
PIN4Q9Y2373EBI-10175124,EBI-714599
POLLQ9UGP5-23EBI-10175124,EBI-10320765
PPP1R18Q6NYC83EBI-10175124,EBI-2557469
PRPF3O433958EBI-10175124,EBI-744322
PSMD14O004873EBI-10175124,EBI-722193
PTRH1Q86Y793EBI-10175124,EBI-2602515
RAB17Q9H0T73EBI-10175124,EBI-721615
RAD51BO153153EBI-10175124,EBI-2824089
RBM17Q96I253EBI-10175124,EBI-740272
RBM23Q86U063EBI-10175124,EBI-780319
RMND1Q9NWS83EBI-10175124,EBI-4401316
RPL9P9P329693EBI-10175124,EBI-358122
RSL24D1Q9UHA33EBI-10175124,EBI-749321
RUSC1Q9BVN23EBI-10175124,EBI-6257312
SDCBPO005605EBI-10175124,EBI-727004
SDCBP2Q9H1903EBI-10175124,EBI-742426
SERPINE2P070933EBI-10175124,EBI-10195168
SFNP319473EBI-10175124,EBI-476295
SLC16A3O154273EBI-10175124,EBI-7600166
SLPIP039733EBI-10175124,EBI-355293
SMN2Q166377EBI-10175124,EBI-395421
SNAP29O957213EBI-10175124,EBI-490676
SNAP47Q5SQN13EBI-10175124,EBI-10244848
SNX20Q7Z6143EBI-10175124,EBI-744896
STK3Q131883EBI-10175124,EBI-992580
SUCLA2E5KS603EBI-10175124,EBI-10176959
SYT17Q9BSW73EBI-10175124,EBI-745392
TBRG4Q969Z03EBI-10175124,EBI-702328
TCEA2Q155603EBI-10175124,EBI-710310
TCEANCQ8N8B73EBI-10175124,EBI-954696
TGFBIQ155823EBI-10175124,EBI-10236573
TRMT61BQ9BVS53EBI-10175124,EBI-3197877
TSG101Q998163EBI-10175124,EBI-346882
TUFMA0A384ME173EBI-10175124,EBI-12261790
TUFMP494113EBI-10175124,EBI-359097
TXN2Q997573EBI-10175124,EBI-2932492
UBE2E2Q96LR53EBI-10175124,EBI-2129763
URB1-AS1Q96HZ75EBI-10175124,EBI-10288943
XRCC4Q134265EBI-10175124,EBI-717592
YARS2Q9Y2Z43EBI-10175124,EBI-1049286
ZCCHC10Q8TBK63EBI-10175124,EBI-597063
ZGPATQ8N5A53EBI-10175124,EBI-3439227
ZGPATQ8N5A5-23EBI-10175124,EBI-10183064
ZNF41P518143EBI-10175124,EBI-2681830
ZNF41P51814-65EBI-10175124,EBI-12700258
ZNF410Q86VK43EBI-10175124,EBI-720304
ZNF567Q8N1843EBI-10175124,EBI-749400
ZNF614Q8N8833EBI-10175124,EBI-9675993

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128131, 151 interactors

Protein interaction database and analysis system

More...
IntActi
Q8IZU0, 133 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000318716

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IZU0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM9 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IV0Y Eukaryota
ENOG41112SU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000062

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112495

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IZU0

Identification of Orthologs from Complete Genome Data

More...
OMAi
RMKMDKA

Database of Orthologous Groups

More...
OrthoDBi
1187915at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IZU0

TreeFam database of animal gene trees

More...
TreeFami
TF328876

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006888 XLR/SYCP3/FAM9_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04803 Cor1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IZU0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAWGKKHAG KDPVRDECEE RNRFTETREE DVTDEHGERE PFAETDEHTG
60 70 80 90 100
ANTKKPEDTA EDLTAKRKRM KMDKTCSKTK NKSKHALRKK QLKRQKRDYI
110 120 130 140 150
HSLKLLNVLE EYITDEQKEE EEEEGEEEEL IRIFQEQQKK WQQYRSVRRE
160 170 180
RLKEMKLLRD QFVKALEDFE DLCDRVFSDE DSELDN
Length:186
Mass (Da):22,438
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i234509A205433927
GO
Isoform 2 (identifier: Q8IZU0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGFLSFLSVSLRSPGSGIASSFPGQPATDPVGRRAAKAQLEAQFM
     61-93: EDLTAKRKRMKMDKTCSKTKNKSKHALRKKQLK → VGANNFKNYPVHIGVSSEQHILLDCSLS

Note: No experimental confirmation available.
Show »
Length:226
Mass (Da):26,138
Checksum:iC4695621D44547BE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PL73E9PL73_HUMAN
Protein FAM9B
FAM9B
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0550871M → MPGFLSFLSVSLRSPGSGIA SSFPGQPATDPVGRRAAKAQ LEAQFM in isoform 2. 1 Publication1
Alternative sequenceiVSP_05508861 – 93EDLTA…KKQLK → VGANNFKNYPVHIGVSSEQH ILLDCSLS in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF494344 mRNA Translation: AAN07163.1
AK097501 mRNA Translation: BAC05078.1
AC074281 Genomic DNA No translation available.
AC119567 Genomic DNA No translation available.
AC119618 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW98763.1
BC120955 mRNA Translation: AAI20956.1
BC120956 mRNA Translation: AAI20957.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14132.1 [Q8IZU0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_995321.1, NM_205849.3 [Q8IZU0-1]
XP_011543766.1, XM_011545464.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000327220; ENSP00000318716; ENSG00000177138 [Q8IZU0-1]
ENST00000362066; ENSP00000354770; ENSG00000177138 [Q8IZU0-2]
ENST00000428477; ENSP00000412606; ENSG00000177138 [Q8IZU0-1]
ENST00000472522; ENSP00000431456; ENSG00000177138 [Q8IZU0-1]
ENST00000651278; ENSP00000498495; ENSG00000177138 [Q8IZU0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
171483

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:171483

UCSC genome browser

More...
UCSCi
uc004csh.4 human [Q8IZU0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF494344 mRNA Translation: AAN07163.1
AK097501 mRNA Translation: BAC05078.1
AC074281 Genomic DNA No translation available.
AC119567 Genomic DNA No translation available.
AC119618 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW98763.1
BC120955 mRNA Translation: AAI20956.1
BC120956 mRNA Translation: AAI20957.1
CCDSiCCDS14132.1 [Q8IZU0-1]
RefSeqiNP_995321.1, NM_205849.3 [Q8IZU0-1]
XP_011543766.1, XM_011545464.2

3D structure databases

SMRiQ8IZU0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi128131, 151 interactors
IntActiQ8IZU0, 133 interactors
STRINGi9606.ENSP00000318716

Protein family/group databases

MoonDBiQ8IZU0 Predicted

Polymorphism and mutation databases

BioMutaiFAM9B
DMDMi29336758

Proteomic databases

jPOSTiQ8IZU0
PaxDbiQ8IZU0
PeptideAtlasiQ8IZU0
PRIDEiQ8IZU0
ProteomicsDBi71428 [Q8IZU0-1]
72351

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000327220; ENSP00000318716; ENSG00000177138 [Q8IZU0-1]
ENST00000362066; ENSP00000354770; ENSG00000177138 [Q8IZU0-2]
ENST00000428477; ENSP00000412606; ENSG00000177138 [Q8IZU0-1]
ENST00000472522; ENSP00000431456; ENSG00000177138 [Q8IZU0-1]
ENST00000651278; ENSP00000498495; ENSG00000177138 [Q8IZU0-1]
GeneIDi171483
KEGGihsa:171483
UCSCiuc004csh.4 human [Q8IZU0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
171483

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAM9B
HGNCiHGNC:18404 FAM9B
HPAiHPA035135
MIMi300478 gene
neXtProtiNX_Q8IZU0
OpenTargetsiENSG00000177138
PharmGKBiPA27993

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IV0Y Eukaryota
ENOG41112SU LUCA
GeneTreeiENSGT00390000000062
HOGENOMiHOG000112495
InParanoidiQ8IZU0
OMAiRMKMDKA
OrthoDBi1187915at2759
PhylomeDBiQ8IZU0
TreeFamiTF328876

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
171483

Protein Ontology

More...
PROi
PR:Q8IZU0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000177138 Expressed in 45 organ(s), highest expression level in testis
ExpressionAtlasiQ8IZU0 baseline and differential
GenevisibleiQ8IZU0 HS

Family and domain databases

InterProiView protein in InterPro
IPR006888 XLR/SYCP3/FAM9_dom
PfamiView protein in Pfam
PF04803 Cor1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFAM9B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IZU0
Secondary accession number(s): Q0IJ68, Q8N7Z8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: March 1, 2003
Last modified: July 31, 2019
This is version 120 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again