Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 170 (13 Nov 2019)
Sequence version 3 (16 Aug 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cohesin subunit SA-2

Gene

STAG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • chromatin binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Chromosome partition, Meiosis, Mitosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1221632 Meiotic synapsis
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2468052 Establishment of Sister Chromatid Cohesion
R-HSA-2470946 Cohesin Loading onto Chromatin
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-9018519 Estrogen-dependent gene expression

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8N3U4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cohesin subunit SA-2
Alternative name(s):
SCC3 homolog 2
Stromal antigen 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STAG2
Synonyms:SA2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11355 STAG2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300826 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N3U4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Neurodevelopmental disorder, X-linked, with craniofacial abnormalities (NEDXCF)5 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA X-linked neurodevelopmental disorder with variable features including intellectual deficiency, microcephaly, microtia, hearing loss, developmental delay, dysmorphic features, language delay, congenital heart defect, and clinodactyly of the 5th finger.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08229369 – 1231Missing in NEDXCF; patient cells show decreased protein abundance; increased sister chromatid cohesion. 1 PublicationAdd BLAST1163
Natural variantiVAR_082294140 – 1231Missing in NEDXCF. 1 PublicationAdd BLAST1092
Natural variantiVAR_082295159Y → C in NEDXCF. 1 Publication1
Natural variantiVAR_082296327S → N in NEDXCF; loss of interaction with RAD21; loss of interaction with cohesin complex. 1 Publication1
Natural variantiVAR_082297535 – 1231Missing in NEDXCF. 1 PublicationAdd BLAST697
Natural variantiVAR_082298604R → Q in NEDXCF; unknown pathological significance. 2 Publications1
Natural variantiVAR_082299743 – 1231Missing in NEDXCF. 1 PublicationAdd BLAST489
Natural variantiVAR_0823001009K → N in NEDXCF. 1 Publication1
Natural variantiVAR_0823011033 – 1231Missing in NEDXCF. 1 PublicationAdd BLAST199

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
10735

MalaCards human disease database

More...
MalaCardsi
STAG2
MIMi301022 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000101972

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
521258 Xq25 microduplication syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36177

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N3U4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
STAG2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
73621291

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001201851 – 1231Cohesin subunit SA-2Add BLAST1231

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei607N6-acetyllysineCombined sources1
Modified residuei1058PhosphoserineCombined sources1
Modified residuei1061PhosphoserineCombined sources1
Modified residuei1064PhosphoserineBy similarity1
Modified residuei1065PhosphoserineBy similarity1
Modified residuei1112PhosphothreonineCombined sources1
Modified residuei1177PhosphoserineCombined sources1
Modified residuei1178PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by PLK1. The large dissociation of cohesin from chromosome arms during prophase is partly due to its phosphorylation (By similarity).By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N3U4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N3U4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N3U4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N3U4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N3U4

PeptideAtlas

More...
PeptideAtlasi
Q8N3U4

PRoteomics IDEntifications database

More...
PRIDEi
Q8N3U4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
71836 [Q8N3U4-1]
71837 [Q8N3U4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N3U4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N3U4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8N3U4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101972 Expressed in 246 organ(s), highest expression level in mucosa of paranasal sinus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N3U4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N3U4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA002857

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts directly with RAD21 in cohesin complex. Cohesin complexes are composed of a heterodimer between a SMC1 protein (SMC1A or SMC1B) and SMC3, which are attached via their hinge domain, and RAD21 which link them at their heads, and one STAG protein (STAG1, STAG2 or STAG3). In cohesin complexes, STAG2 is mutually exclusive with STAG1 and STAG3.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115958, 60 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8N3U4

Database of interacting proteins

More...
DIPi
DIP-35418N

Protein interaction database and analysis system

More...
IntActi
Q8N3U4, 38 interactors

Molecular INTeraction database

More...
MINTi
Q8N3U4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000218089

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11231
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N3U4

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini293 – 378SCDPROSITE-ProRule annotationAdd BLAST86

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1096 – 1101Poly-Ser6

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SCC3 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2011 Eukaryota
COG5537 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182972

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N3U4

KEGG Orthology (KO)

More...
KOi
K06671

Identification of Orthologs from Complete Genome Data

More...
OMAi
ICDLLII

Database of Orthologous Groups

More...
OrthoDBi
167826at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N3U4

TreeFam database of animal gene trees

More...
TreeFami
TF314604

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR039662 Cohesin_Scc3/SA
IPR020839 SCD
IPR013721 STAG

The PANTHER Classification System

More...
PANTHERi
PTHR11199 PTHR11199, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08514 STAG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51425 SCD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N3U4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIAAPEIPTD FNLLQESETH FSSDTDFEDI EGKNQKQGKG KTCKKGKKGP
60 70 80 90 100
AEKGKGGNGG GKPPSGPNRM NGHHQQNGVE NMMLFEVVKM GKSAMQSVVD
110 120 130 140 150
DWIESYKHDR DIALLDLINF FIQCSGCKGV VTAEMFRHMQ NSEIIRKMTE
160 170 180 190 200
EFDEDSGDYP LTMAGPQWKK FKSSFCEFIG VLVRQCQYSI IYDEYMMDTV
210 220 230 240 250
ISLLTGLSDS QVRAFRHTST LAAMKLMTAL VNVALNLSIN MDNTQRQYEA
260 270 280 290 300
ERNKMIGKRA NERLELLLQK RKELQENQDE IENMMNAIFK GVFVHRYRDA
310 320 330 340 350
IAEIRAICIE EIGIWMKMYS DAFLNDSYLK YVGWTMHDKQ GEVRLKCLTA
360 370 380 390 400
LQGLYYNKEL NSKLELFTSR FKDRIVSMTL DKEYDVAVQA IKLLTLVLQS
410 420 430 440 450
SEEVLTAEDC ENVYHLVYSA HRPVAVAAGE FLYKKLFSRR DPEEDGMMKR
460 470 480 490 500
RGRQGPNANL VKTLVFFFLE SELHEHAAYL VDSMWDCATE LLKDWECMNS
510 520 530 540 550
LLLEEPLSGE EALTDRQESA LIEIMLCTIR QAAECHPPVG RGTGKRVLTA
560 570 580 590 600
KEKKTQLDDR TKITELFAVA LPQLLAKYSV DAEKVTNLLQ LPQYFDLEIY
610 620 630 640 650
TTGRLEKHLD ALLRQIRNIV EKHTDTDVLE ACSKTYHALC NEEFTIFNRV
660 670 680 690 700
DISRSQLIDE LADKFNRLLE DFLQEGEEPD EDDAYQVLST LKRITAFHNA
710 720 730 740 750
HDLSKWDLFA CNYKLLKTGI ENGDMPEQIV IHALQCTHYV ILWQLAKITE
760 770 780 790 800
SSSTKEDLLR LKKQMRVFCQ ICQHYLTNVN TTVKEQAFTI LCDILMIFSH
810 820 830 840 850
QIMSGGRDML EPLVYTPDSS LQSELLSFIL DHVFIEQDDD NNSADGQQED
860 870 880 890 900
EASKIEALHK RRNLLAAFCK LIVYTVVEMN TAADIFKQYM KYYNDYGDII
910 920 930 940 950
KETMSKTRQI DKIQCAKTLI LSLQQLFNEM IQENGYNFDR SSSTFSGIKE
960 970 980 990 1000
LARRFALTFG LDQLKTREAI AMLHKDGIEF AFKEPNPQGE SHPPLNLAFL
1010 1020 1030 1040 1050
DILSEFSSKL LRQDKRTVYV YLEKFMTFQM SLRREDVWLP LMSYRNSLLA
1060 1070 1080 1090 1100
GGDDDTMSVI SGISSRGSTV RSKKSKPSTG KRKVVEGMQL SLTEESSSSD
1110 1120 1130 1140 1150
SMWLSREQTL HTPVMMQTPQ LTSTIMREPK RLRPEDSFMS VYPMQTEHHQ
1160 1170 1180 1190 1200
TPLDYNRRGT SLMEDDEEPI VEDVMMSSEG RIEDLNEGMD FDTMDIDLPP
1210 1220 1230
SKNRRERTEL KPDFFDPASI MDESVLGVSM F
Length:1,231
Mass (Da):141,326
Last modified:August 16, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i692358EFFFF61BB9
GO
Isoform 2 (identifier: Q8N3U4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1156-1156: N → NTQVTWMLAQRQQEEARQQQERAAMSYVKLRTNLQHAI

Show »
Length:1,268
Mass (Da):145,751
Checksum:i38F24736F06D9054
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AMT4B1AMT4_HUMAN
Cohesin subunit SA-2
STAG2
548Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AMT3B1AMT3_HUMAN
Cohesin subunit SA-2
STAG2
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AMT0B1AMT0_HUMAN
Cohesin subunit SA-2
STAG2
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AMT1B1AMT1_HUMAN
Cohesin subunit SA-2
STAG2
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AMT2B1AMT2_HUMAN
Cohesin subunit SA-2
STAG2
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AMS8B1AMS8_HUMAN
Cohesin subunit SA-2
STAG2
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AMS9B1AMS9_HUMAN
Cohesin subunit SA-2
STAG2
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ERE6E7ERE6_HUMAN
Cohesin subunit SA-2
STAG2
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA99732 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti46G → D in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti302A → R in CAA99732 (PubMed:9305759).Curated1
Sequence conflicti327S → G in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti607 – 608KH → ND in CAA99732 (PubMed:9305759).Curated2
Sequence conflicti706W → R in CAA99732 (PubMed:9305759).Curated1
Sequence conflicti710A → V in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti835I → T in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti971A → T in CAH18271 (PubMed:17974005).Curated1
Sequence conflicti992H → Y in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti1105S → T in CAA99732 (PubMed:9305759).Curated1
Sequence conflicti1144M → K in CAA99732 (PubMed:9305759).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08229369 – 1231Missing in NEDXCF; patient cells show decreased protein abundance; increased sister chromatid cohesion. 1 PublicationAdd BLAST1163
Natural variantiVAR_082294140 – 1231Missing in NEDXCF. 1 PublicationAdd BLAST1092
Natural variantiVAR_082295159Y → C in NEDXCF. 1 Publication1
Natural variantiVAR_082296327S → N in NEDXCF; loss of interaction with RAD21; loss of interaction with cohesin complex. 1 Publication1
Natural variantiVAR_082297535 – 1231Missing in NEDXCF. 1 PublicationAdd BLAST697
Natural variantiVAR_082298604R → Q in NEDXCF; unknown pathological significance. 2 Publications1
Natural variantiVAR_060114699N → K. Corresponds to variant dbSNP:rs6655782Ensembl.1
Natural variantiVAR_082299743 – 1231Missing in NEDXCF. 1 PublicationAdd BLAST489
Natural variantiVAR_0823001009K → N in NEDXCF. 1 Publication1
Natural variantiVAR_0823011033 – 1231Missing in NEDXCF. 1 PublicationAdd BLAST199

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0411191156N → NTQVTWMLAQRQQEEARQQQ ERAAMSYVKLRTNLQHAI in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL831939 mRNA Translation: CAD38591.1
CR749433 mRNA Translation: CAH18271.1
AL355476 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11853.1
CH471107 Genomic DNA Translation: EAX11854.1
CH471107 Genomic DNA Translation: EAX11855.1
CH471107 Genomic DNA Translation: EAX11856.1
CH471107 Genomic DNA Translation: EAX11857.1
BC001765 mRNA Translation: AAH01765.2
Z75331 mRNA Translation: CAA99732.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14607.1 [Q8N3U4-1]
CCDS43990.1 [Q8N3U4-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001036214.1, NM_001042749.2 [Q8N3U4-2]
NP_001036215.1, NM_001042750.1 [Q8N3U4-2]
NP_001036216.1, NM_001042751.1 [Q8N3U4-1]
NP_001269347.1, NM_001282418.1 [Q8N3U4-1]
NP_006594.3, NM_006603.4 [Q8N3U4-1]
XP_005262414.1, XM_005262357.2 [Q8N3U4-2]
XP_005262415.1, XM_005262358.2 [Q8N3U4-2]
XP_005262416.1, XM_005262359.3 [Q8N3U4-2]
XP_005262417.1, XM_005262360.2 [Q8N3U4-2]
XP_005262418.1, XM_005262361.2 [Q8N3U4-1]
XP_006724790.1, XM_006724727.1 [Q8N3U4-2]
XP_011529555.1, XM_011531253.2 [Q8N3U4-2]
XP_016884721.1, XM_017029232.1 [Q8N3U4-1]
XP_016884722.1, XM_017029233.1 [Q8N3U4-1]
XP_016884723.1, XM_017029234.1 [Q8N3U4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000218089; ENSP00000218089; ENSG00000101972 [Q8N3U4-2]
ENST00000371144; ENSP00000360186; ENSG00000101972 [Q8N3U4-1]
ENST00000371145; ENSP00000360187; ENSG00000101972 [Q8N3U4-2]
ENST00000371157; ENSP00000360199; ENSG00000101972 [Q8N3U4-1]
ENST00000371160; ENSP00000360202; ENSG00000101972 [Q8N3U4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10735

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10735

UCSC genome browser

More...
UCSCi
uc004eua.5 human [Q8N3U4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL831939 mRNA Translation: CAD38591.1
CR749433 mRNA Translation: CAH18271.1
AL355476 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11853.1
CH471107 Genomic DNA Translation: EAX11854.1
CH471107 Genomic DNA Translation: EAX11855.1
CH471107 Genomic DNA Translation: EAX11856.1
CH471107 Genomic DNA Translation: EAX11857.1
BC001765 mRNA Translation: AAH01765.2
Z75331 mRNA Translation: CAA99732.1 Different initiation.
CCDSiCCDS14607.1 [Q8N3U4-1]
CCDS43990.1 [Q8N3U4-2]
RefSeqiNP_001036214.1, NM_001042749.2 [Q8N3U4-2]
NP_001036215.1, NM_001042750.1 [Q8N3U4-2]
NP_001036216.1, NM_001042751.1 [Q8N3U4-1]
NP_001269347.1, NM_001282418.1 [Q8N3U4-1]
NP_006594.3, NM_006603.4 [Q8N3U4-1]
XP_005262414.1, XM_005262357.2 [Q8N3U4-2]
XP_005262415.1, XM_005262358.2 [Q8N3U4-2]
XP_005262416.1, XM_005262359.3 [Q8N3U4-2]
XP_005262417.1, XM_005262360.2 [Q8N3U4-2]
XP_005262418.1, XM_005262361.2 [Q8N3U4-1]
XP_006724790.1, XM_006724727.1 [Q8N3U4-2]
XP_011529555.1, XM_011531253.2 [Q8N3U4-2]
XP_016884721.1, XM_017029232.1 [Q8N3U4-1]
XP_016884722.1, XM_017029233.1 [Q8N3U4-1]
XP_016884723.1, XM_017029234.1 [Q8N3U4-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4PJUX-ray3.05A80-1060[»]
4PJWX-ray2.85A80-1060[»]
4PK7X-ray2.95A80-1060[»]
SMRiQ8N3U4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi115958, 60 interactors
CORUMiQ8N3U4
DIPiDIP-35418N
IntActiQ8N3U4, 38 interactors
MINTiQ8N3U4
STRINGi9606.ENSP00000218089

PTM databases

iPTMnetiQ8N3U4
PhosphoSitePlusiQ8N3U4
SwissPalmiQ8N3U4

Polymorphism and mutation databases

BioMutaiSTAG2
DMDMi73621291

Proteomic databases

EPDiQ8N3U4
jPOSTiQ8N3U4
MassIVEiQ8N3U4
MaxQBiQ8N3U4
PaxDbiQ8N3U4
PeptideAtlasiQ8N3U4
PRIDEiQ8N3U4
ProteomicsDBi71836 [Q8N3U4-1]
71837 [Q8N3U4-2]

Genome annotation databases

EnsembliENST00000218089; ENSP00000218089; ENSG00000101972 [Q8N3U4-2]
ENST00000371144; ENSP00000360186; ENSG00000101972 [Q8N3U4-1]
ENST00000371145; ENSP00000360187; ENSG00000101972 [Q8N3U4-2]
ENST00000371157; ENSP00000360199; ENSG00000101972 [Q8N3U4-1]
ENST00000371160; ENSP00000360202; ENSG00000101972 [Q8N3U4-1]
GeneIDi10735
KEGGihsa:10735
UCSCiuc004eua.5 human [Q8N3U4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10735
DisGeNETi10735

GeneCards: human genes, protein and diseases

More...
GeneCardsi
STAG2
HGNCiHGNC:11355 STAG2
HPAiHPA002857
MalaCardsiSTAG2
MIMi300826 gene
301022 phenotype
neXtProtiNX_Q8N3U4
OpenTargetsiENSG00000101972
Orphaneti521258 Xq25 microduplication syndrome
PharmGKBiPA36177

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2011 Eukaryota
COG5537 LUCA
GeneTreeiENSGT00950000182972
InParanoidiQ8N3U4
KOiK06671
OMAiICDLLII
OrthoDBi167826at2759
PhylomeDBiQ8N3U4
TreeFamiTF314604

Enzyme and pathway databases

ReactomeiR-HSA-1221632 Meiotic synapsis
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2468052 Establishment of Sister Chromatid Cohesion
R-HSA-2470946 Cohesin Loading onto Chromatin
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-9018519 Estrogen-dependent gene expression
SIGNORiQ8N3U4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
STAG2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
STAG2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10735
PharosiQ8N3U4

Protein Ontology

More...
PROi
PR:Q8N3U4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101972 Expressed in 246 organ(s), highest expression level in mucosa of paranasal sinus
ExpressionAtlasiQ8N3U4 baseline and differential
GenevisibleiQ8N3U4 HS

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR039662 Cohesin_Scc3/SA
IPR020839 SCD
IPR013721 STAG
PANTHERiPTHR11199 PTHR11199, 2 hits
PfamiView protein in Pfam
PF08514 STAG, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51425 SCD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTAG2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N3U4
Secondary accession number(s): B1AMT5
, D3DTF5, O00540, Q5JTI6, Q68DE9, Q9H1N8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: August 16, 2005
Last modified: November 13, 2019
This is version 170 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again