Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (13 Nov 2019)
Sequence version 2 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sodium-coupled neutral amino acid transporter 9

Gene

SLC38A9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Lysosomal amino acid transporter involved in the activation of mTORC1 in response to amino acid levels. Probably acts as an amino acid sensor of the Rag GTPases and Ragulator complexes, 2 complexes involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed:25561175, PubMed:25567906, PubMed:29053970). Following activation by amino acids, the Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. SLC38A9 mediates transport of amino acids with low capacity and specificity with a slight preference for polar amino acids (PubMed:25561175, PubMed:25567906). Acts as an arginine sensor (PubMed:25567906, PubMed:29053970). Following activation by arginine binding, mediates transport of leucine, tyrosine and phenylalanine with high efficiency, and is required for the efficient utilization of these amino acids after lysosomal protein degradation (PubMed:29053970).3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Amino acid transport is sodium-dependent (By similarity). Transport of leucine, tyrosine and phenylalanine is increased by arginine binding (PubMed:29053970).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAmino-acid transport, Transport
LigandMetal-binding, Sodium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1632852 Macroautophagy
R-HSA-165159 mTOR signalling
R-HSA-166208 mTORC1-mediated signalling
R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK
R-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-8943724 Regulation of PTEN gene transcription
R-HSA-9639288 Amino acids regulate mTORC1

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8NBW4

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.18.9.1 the amino acid/auxin permease (aaap) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium-coupled neutral amino acid transporter 9Curated
Alternative name(s):
Solute carrier family 38 member 9Imported
Up-regulated in lung cancer 111 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC38A9Imported
Synonyms:URLC111 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26907 SLC38A9

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616203 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NBW4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 119Cytoplasmic1 PublicationAdd BLAST119
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei120 – 140Helical; Name=1By similarityAdd BLAST21
Topological domaini141 – 146LumenalCurated6
Transmembranei147 – 167Helical; Name=2By similarityAdd BLAST21
Topological domaini168 – 198CytoplasmicCuratedAdd BLAST31
Transmembranei199 – 225Helical; Name=3By similarityAdd BLAST27
Topological domaini226 – 283LumenalCuratedAdd BLAST58
Transmembranei284 – 300Helical; Name=4By similarityAdd BLAST17
Topological domaini301 – 309CytoplasmicCurated9
Transmembranei310 – 334Helical; Name=5By similarityAdd BLAST25
Topological domaini335 – 356LumenalCuratedAdd BLAST22
Transmembranei357 – 377Helical; Name=6By similarityAdd BLAST21
Topological domaini378 – 394CytoplasmicCuratedAdd BLAST17
Transmembranei395 – 415Helical; Name=7By similarityAdd BLAST21
Topological domaini416 – 437LumenalCuratedAdd BLAST22
Transmembranei438 – 458Helical; Name=8By similarityAdd BLAST21
Topological domaini459 – 479CytoplasmicCuratedAdd BLAST21
Transmembranei480 – 500Helical; Name=9By similarityAdd BLAST21
Topological domaini501 – 507LumenalCurated7
Transmembranei508 – 528Helical; Name=10By similarityAdd BLAST21
Topological domaini529 – 540CytoplasmicCuratedAdd BLAST12
Transmembranei541 – 561Helical; Name=11By similarityAdd BLAST21

Keywords - Cellular componenti

Endosome, Lysosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi38 – 40RPF → AAA: Abolishes interaction with the Ragulator and Rag GTPases complexes. 1 Publication3
Mutagenesisi60H → A: Does not affect association with the Ragulator complex. 1 Publication1
Mutagenesisi68I → A: Abolishes association with the Ragulator complex. No effect on amino acid transport activity. 2 Publications1
Mutagenesisi70 – 73YYSR → AAAA: Abolishes interaction with the Ragulator and Rag GTPases complexes. 1 Publication4
Mutagenesisi71Y → A: Abolishes association with the Ragulator complex. 1 Publication1
Mutagenesisi74L → A: Abolishes association with the Ragulator complex. 1 Publication1
Mutagenesisi85 – 87PDH → AAA: Abolishes interaction with the Ragulator and Rag GTPases complexes. 1 Publication3
Mutagenesisi85P → A: Abolishes association with the Ragulator complex. 1 Publication1
Mutagenesisi90P → A: Abolishes association with the Ragulator complex. 1 Publication1
Mutagenesisi98 – 101YSPL → AAAA: Does not affect interaction with the Ragulator and Rag GTPases complexes. 1 Publication4
Mutagenesisi128N → A: Moderately affects amino acid transport. 1 Publication1
Mutagenesisi133T → W: Abolishes arginine transport. No effect on subcellular location and interaction with Ragulator complex. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
153129

Open Targets

More...
OpenTargetsi
ENSG00000177058

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162403774

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NBW4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC38A9

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296452888

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003288401 – 561Sodium-coupled neutral amino acid transporter 9Add BLAST561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi239N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi248N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi255 ↔ 424By similarity
Glycosylationi266N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi274N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8NBW4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NBW4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NBW4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NBW4

PeptideAtlas

More...
PeptideAtlasi
Q8NBW4

PRoteomics IDEntifications database

More...
PRIDEi
Q8NBW4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
3820
6851
72830 [Q8NBW4-1]
72831 [Q8NBW4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NBW4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NBW4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000177058 Expressed in 183 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NBW4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NBW4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043785

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associated component of the Ragulator complex (composed of LAMTOR1, LAMTOR2, LAMTOR3, LAMTOR4 and LAMTOR5). Associated component of the Rag GTPases heterodimers (composed of RRAGA, RRAGB, RRAGC and RRAGD).

Interacts with TM4SF5 (PubMed:30956113).

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127480, 21 interactors

Database of interacting proteins

More...
DIPi
DIP-61480N

Protein interaction database and analysis system

More...
IntActi
Q8NBW4, 26 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000380074

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni129 – 134Important for arginine binding and amino acid transportBy similarity6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The cytosolic N-terminus part of the protein mediates interaction with the Ragulator complex and the Rag GTPases heterodimers.2 Publications

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1305 Eukaryota
COG0814 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005646

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000294102

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NBW4

KEGG Orthology (KO)

More...
KOi
K14995

Identification of Orthologs from Complete Genome Data

More...
OMAi
EASAMNK

Database of Orthologous Groups

More...
OrthoDBi
941044at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NBW4

TreeFam database of animal gene trees

More...
TreeFami
TF312989

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013057 AA_transpt_TM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01490 Aa_trans, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NBW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANMNSDSRH LGTSEVDHER DPGPMNIQFE PSDLRSKRPF CIEPTNIVNV
60 70 80 90 100
NHVIQRVSDH ASAMNKRIHY YSRLTTPADK ALIAPDHVVP APEECYVYSP
110 120 130 140 150
LGSAYKLQSY TEGYGKNTSL VTIFMIWNTM MGTSILSIPW GIKQAGFTTG
160 170 180 190 200
MCVIILMGLL TLYCCYRVVK SRTMMFSLDT TSWEYPDVCR HYFGSFGQWS
210 220 230 240 250
SLLFSLVSLI GAMIVYWVLM SNFLFNTGKF IFNFIHHIND TDTILSTNNS
260 270 280 290 300
NPVICPSAGS GGHPDNSSMI FYANDTGAQQ FEKWWDKSRT VPFYLVGLLL
310 320 330 340 350
PLLNFKSPSF FSKFNILGTV SVLYLIFLVT FKAVRLGFHL EFHWFIPTEF
360 370 380 390 400
FVPEIRFQFP QLTGVLTLAF FIHNCIITLL KNNKKQENNV RDLCIAYMLV
410 420 430 440 450
TLTYLYIGVL VFASFPSPPL SKDCIEQNFL DNFPSSDTLS FIARIFLLFQ
460 470 480 490 500
MMTVYPLLGY LARVQLLGHI FGDIYPSIFH VLILNLIIVG AGVIMACFYP
510 520 530 540 550
NIGGIIRYSG AACGLAFVFI YPSLIYIISL HQEERLTWPK LIFHVFIIIL
560
GVANLIVQFF M
Length:561
Mass (Da):63,776
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0C1A3A136158168A
GO
Isoform 2 (identifier: Q8NBW4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     428-561: NFLDNFPSSD...VANLIVQFFM → VRHRVPSLCDCVHFHVFIVGRVIQWQDITSDRPGF

Note: No experimental confirmation available.
Show »
Length:462
Mass (Da):52,717
Checksum:iFB8344A9CFD7392F
GO
Isoform 3 (identifier: Q8NBW4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSK → MAICILTWRI
     318-353: Missing.

Show »
Length:498
Mass (Da):56,542
Checksum:iA54A4DA31CC0B696
GO
Isoform 4 (identifier: Q8NBW4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.

Show »
Length:498
Mass (Da):56,695
Checksum:iD213355DA1CD5C13
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B3KVK8B3KVK8_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9 FLJ90709, hCG_40989
437Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9Q7D6R9Q7_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
455Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RER8D6RER8_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RG31D6RG31_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RHF5D6RHF5_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
397Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RIW7D6RIW7_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
26Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ESU6E7ESU6_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9X0D6R9X0_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBB9D6RBB9_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDH2D6RDH2_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAQ19756 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti84A → P in AAH66891 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_042546182S → T3 PublicationsCorresponds to variant dbSNP:rs4865615Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451101 – 63Missing in isoform 4. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_0451111 – 37MANMN…DLRSK → MAICILTWRI in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_045112318 – 353Missing in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_032815428 – 561NFLDN…VQFFM → VRHRVPSLCDCVHFHVFIVG RVIQWQDITSDRPGF in isoform 2. 1 PublicationAdd BLAST134

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK075190 mRNA Translation: BAC11460.1
AK127988 mRNA Translation: BAG54613.1
AK301850 mRNA Translation: BAH13566.1
AB105188 mRNA Translation: BAQ19756.1 Different initiation.
AC008784 Genomic DNA No translation available.
AC016632 Genomic DNA No translation available.
CH471123 Genomic DNA Translation: EAW54926.1
BC066891 mRNA Translation: AAH66891.1
BC101362 mRNA Translation: AAI01363.1
BX641065 mRNA Translation: CAE46032.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3968.1 [Q8NBW4-1]
CCDS58947.1 [Q8NBW4-4]
CCDS58948.1 [Q8NBW4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001245215.1, NM_001258286.1 [Q8NBW4-4]
NP_001245216.1, NM_001258287.1 [Q8NBW4-3]
NP_775785.2, NM_173514.3 [Q8NBW4-1]
XP_006714600.1, XM_006714537.2
XP_006714601.1, XM_006714538.3
XP_006714602.1, XM_006714539.3 [Q8NBW4-1]
XP_011541475.1, XM_011543173.1
XP_011541476.1, XM_011543174.1 [Q8NBW4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000318672; ENSP00000316596; ENSG00000177058 [Q8NBW4-1]
ENST00000396865; ENSP00000380074; ENSG00000177058 [Q8NBW4-1]
ENST00000512595; ENSP00000427335; ENSG00000177058 [Q8NBW4-3]
ENST00000515629; ENSP00000420934; ENSG00000177058 [Q8NBW4-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
153129

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:153129

UCSC genome browser

More...
UCSCi
uc003jqd.4 human [Q8NBW4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK075190 mRNA Translation: BAC11460.1
AK127988 mRNA Translation: BAG54613.1
AK301850 mRNA Translation: BAH13566.1
AB105188 mRNA Translation: BAQ19756.1 Different initiation.
AC008784 Genomic DNA No translation available.
AC016632 Genomic DNA No translation available.
CH471123 Genomic DNA Translation: EAW54926.1
BC066891 mRNA Translation: AAH66891.1
BC101362 mRNA Translation: AAI01363.1
BX641065 mRNA Translation: CAE46032.1
CCDSiCCDS3968.1 [Q8NBW4-1]
CCDS58947.1 [Q8NBW4-4]
CCDS58948.1 [Q8NBW4-3]
RefSeqiNP_001245215.1, NM_001258286.1 [Q8NBW4-4]
NP_001245216.1, NM_001258287.1 [Q8NBW4-3]
NP_775785.2, NM_173514.3 [Q8NBW4-1]
XP_006714600.1, XM_006714537.2
XP_006714601.1, XM_006714538.3
XP_006714602.1, XM_006714539.3 [Q8NBW4-1]
XP_011541475.1, XM_011543173.1
XP_011541476.1, XM_011543174.1 [Q8NBW4-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi127480, 21 interactors
DIPiDIP-61480N
IntActiQ8NBW4, 26 interactors
STRINGi9606.ENSP00000380074

Protein family/group databases

TCDBi2.A.18.9.1 the amino acid/auxin permease (aaap) family

PTM databases

iPTMnetiQ8NBW4
PhosphoSitePlusiQ8NBW4

Polymorphism and mutation databases

BioMutaiSLC38A9
DMDMi296452888

Proteomic databases

jPOSTiQ8NBW4
MassIVEiQ8NBW4
MaxQBiQ8NBW4
PaxDbiQ8NBW4
PeptideAtlasiQ8NBW4
PRIDEiQ8NBW4
ProteomicsDBi3820
6851
72830 [Q8NBW4-1]
72831 [Q8NBW4-2]

Genome annotation databases

EnsembliENST00000318672; ENSP00000316596; ENSG00000177058 [Q8NBW4-1]
ENST00000396865; ENSP00000380074; ENSG00000177058 [Q8NBW4-1]
ENST00000512595; ENSP00000427335; ENSG00000177058 [Q8NBW4-3]
ENST00000515629; ENSP00000420934; ENSG00000177058 [Q8NBW4-4]
GeneIDi153129
KEGGihsa:153129
UCSCiuc003jqd.4 human [Q8NBW4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
153129
DisGeNETi153129

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC38A9
HGNCiHGNC:26907 SLC38A9
HPAiHPA043785
MIMi616203 gene
neXtProtiNX_Q8NBW4
OpenTargetsiENSG00000177058
PharmGKBiPA162403774

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1305 Eukaryota
COG0814 LUCA
GeneTreeiENSGT00390000005646
HOGENOMiHOG000294102
InParanoidiQ8NBW4
KOiK14995
OMAiEASAMNK
OrthoDBi941044at2759
PhylomeDBiQ8NBW4
TreeFamiTF312989

Enzyme and pathway databases

ReactomeiR-HSA-1632852 Macroautophagy
R-HSA-165159 mTOR signalling
R-HSA-166208 mTORC1-mediated signalling
R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK
R-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-8943724 Regulation of PTEN gene transcription
R-HSA-9639288 Amino acids regulate mTORC1
SIGNORiQ8NBW4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC38A9 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
153129
PharosiQ8NBW4

Protein Ontology

More...
PROi
PR:Q8NBW4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000177058 Expressed in 183 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ8NBW4 baseline and differential
GenevisibleiQ8NBW4 HS

Family and domain databases

InterProiView protein in InterPro
IPR013057 AA_transpt_TM
PfamiView protein in Pfam
PF01490 Aa_trans, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS38A9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NBW4
Secondary accession number(s): A0A0A8K8P2
, B3KXV1, B7Z7D0, Q0P5S0, Q6MZJ8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 18, 2010
Last modified: November 13, 2019
This is version 137 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again