Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (13 Feb 2019)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Interleukin-31 receptor subunit alpha

Gene

IL31RA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5 (PubMed:11877449, PubMed:14504285, PubMed:15627637, PubMed:15194700). May function in skin immunity (PubMed:15184896). Mediates IL31-induced itch, probably in a manner dependent on cation channels TRPA1 and TRPV1 (By similarity). Positively regulates numbers and cycling status of immature subsets of myeloid progenitor cells in bone marrow in vivo and enhances myeloid progenitor cell survival in vitro (By similarity).By similarity5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processImmunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6788467 IL-6-type cytokine receptor ligand interactions

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8NI17

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8NI17

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-31 receptor subunit alpha
Short name:
IL-31 receptor subunit alpha
Short name:
IL-31R subunit alpha
Short name:
IL-31R-alpha
Short name:
IL-31RA
Alternative name(s):
Cytokine receptor-like 3
GLM-R
Short name:
hGLM-R
Gp130-like monocyte receptor
Short name:
Gp130-like receptor
ZcytoR17
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IL31RA
Synonyms:CRL3, GPL
ORF Names:UNQ6368/PRO21073/PRO21384
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164509.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18969 IL31RA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609510 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NI17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini20 – 519ExtracellularSequence analysisAdd BLAST500
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei520 – 540HelicalSequence analysisAdd BLAST21
Topological domaini541 – 732CytoplasmicSequence analysisAdd BLAST192

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Amyloidosis, primary localized cutaneous, 2 (PLCA2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary amyloidosis characterized by localized cutaneous amyloid deposition. This condition usually presents with itching (especially on the lower legs) and visible changes of skin hyperpigmentation and thickening that may be exacerbated by chronic scratching and rubbing. Primary localized cutaneous amyloidosis is often divided into macular and lichen subtypes although many affected individuals often show both variants coexisting. Lichen amyloidosis characteristically presents as a pruritic eruption of grouped hyperkeratotic papules with a predilection for the shins, calves, ankles and dorsa of feet and thighs. Papules may coalesce to form hyperkeratotic plaques that can resemble lichen planus, lichen simplex or nodular prurigo. Macular amyloidosis is characterized by small pigmented macules that may merge to produce macular hyperpigmentation, sometimes with a reticulate or rippled pattern. In macular and lichen amyloidosis, amyloid is deposited in the papillary dermis in association with grouped colloid bodies, thought to represent degenerate basal keratinocytes. The amyloid deposits probably reflect a combination of degenerate keratin filaments, serum amyloid P component, and deposition of immunoglobulins.
See also OMIM:613955
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_065809489S → F in PLCA2. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi639Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-670 and A-708. 2 Publications1
Mutagenesisi639Y → F: Abrogates STAT5 activation. Mild effect on STAT1 activation. No effect on STAT3 activation. 2 Publications1
Mutagenesisi670Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-708. 2 Publications1
Mutagenesisi670Y → F: No effect on STAT3 and STAT5 activation. Mild effect on STAT1 activation. 2 Publications1
Mutagenesisi708Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-670. 2 Publications1
Mutagenesisi708Y → F: Abrogates STAT3 activation. Loss of interaction with STAT3. Mild effect on STAT1 activation. No effect on STAT5 activation. 2 Publications1

Keywords - Diseasei

Amyloidosis, Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
133396

MalaCards human disease database

More...
MalaCardsi
IL31RA
MIMi613955 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000164509

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
353220 Familial primary localized cutaneous amyloidosis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134952624

Chemistry databases

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1710

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IL31RA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74730327

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 191 PublicationAdd BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000027457220 – 732Interleukin-31 receptor subunit alphaAdd BLAST713

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi37N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi67N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi93N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi166N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi187N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi277N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi283N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi395N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi455N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi504N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NI17

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NI17

PeptideAtlas

More...
PeptideAtlasi
Q8NI17

PRoteomics IDEntifications database

More...
PRIDEi
Q8NI17

ProteomicsDB human proteome resource

More...
ProteomicsDBi
73801
73802 [Q8NI17-10]
73803 [Q8NI17-11]
73804 [Q8NI17-12]
73805 [Q8NI17-2]
73806 [Q8NI17-3]
73807 [Q8NI17-4]
73808 [Q8NI17-5]
73809 [Q8NI17-6]
73810 [Q8NI17-7]
73811 [Q8NI17-8]
73812 [Q8NI17-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NI17

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NI17

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in CD14- and CD56-positive blood cells (PubMed:11877449). Expressed in macrophages (PubMed:16461143, PubMed:18439099). Expressed in keratinocytes (PubMed:21261663). Expressed in a subset of dorsal root ganglia neurons (at protein level) (PubMed:24373353). Expressed at low levels in testis, ovary, brain, prostate, placenta, thymus, bone marrow, trachea and skin (PubMed:15184896, PubMed:11877449, PubMed:14504285). Expressed in bronchial and alveolar epithelial cells and pulmonary fibroblasts (PubMed:18439099). Detected in all of the myelomonocytic lineage (PubMed:14504285). Isoform 6: Expressed at higher levels in lesional skin compared to healthy skin of atopic dermatitis patients (PubMed:24373353).7 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in lesional keratinocytes of patients with atopic dermatitis (PubMed:16461143). Up-regulated by IFNG/IFN-gamma (PubMed:11877449, PubMed:14504285, PubMed:15184896, PubMed:21261663, PubMed:18439099). Up-regulated by bacterial lipopolysaccharides (LPS) (PubMed:11877449, PubMed:15184896, PubMed:14504285). Up-regulated by triacylated lipoprotein (Pam3Cys) (PubMed:21261663). Up-regulated by TGFB1/TGF-beta (PubMed:18439099).6 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164509 Expressed in 82 organ(s), highest expression level in thoracic aorta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NI17 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NI17 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA051532
HPA068114

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with OSMR. Interacts with JAK1 and STAT3.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126357, 26 interactors

Protein interaction database and analysis system

More...
IntActi
Q8NI17, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000415900

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8NI17

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8NI17

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini24 – 122Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST99
Domaini124 – 225Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST102
Domaini223 – 315Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST93
Domaini319 – 416Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST98
Domaini421 – 515Fibronectin type-III 5PROSITE-ProRule annotationAdd BLAST95

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJG6 Eukaryota
ENOG410YAI2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155603

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG081788

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NI17

KEGG Orthology (KO)

More...
KOi
K22630

Identification of Orthologs from Complete Genome Data

More...
OMAi
CTWSPEK

Database of Orthologous Groups

More...
OrthoDBi
144839at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NI17

TreeFam database of animal gene trees

More...
TreeFami
TF338122

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 5 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR015321 TypeI_recpt_CBD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041 fn3, 2 hits
PF09240 IL6Ra-bind, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265 SSF49265, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (12+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 12 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 12 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NI17-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMWTWALWML PSLCKFSLAA LPAKPENISC VYYYRKNLTC TWSPGKETSY
60 70 80 90 100
TQYTVKRTYA FGEKHDNCTT NSSTSENRAS CSFFLPRITI PDNYTIEVEA
110 120 130 140 150
ENGDGVIKSH MTYWRLENIA KTEPPKIFRV KPVLGIKRMI QIEWIKPELA
160 170 180 190 200
PVSSDLKYTL RFRTVNSTSW MEVNFAKNRK DKNQTYNLTG LQPFTEYVIA
210 220 230 240 250
LRCAVKESKF WSDWSQEKMG MTEEEAPCGL ELWRVLKPAE ADGRRPVRLL
260 270 280 290 300
WKKARGAPVL EKTLGYNIWY YPESNTNLTE TMNTTNQQLE LHLGGESFWV
310 320 330 340 350
SMISYNSLGK SPVATLRIPA IQEKSFQCIE VMQACVAEDQ LVVKWQSSAL
360 370 380 390 400
DVNTWMIEWF PDVDSEPTTL SWESVSQATN WTIQQDKLKP FWCYNISVYP
410 420 430 440 450
MLHDKVGEPY SIQAYAKEGV PSEGPETKVE NIGVKTVTIT WKEIPKSERK
460 470 480 490 500
GIICNYTIFY QAEGGKGFSK TVNSSILQYG LESLKRKTSY IVQVMASTSA
510 520 530 540 550
GGTNGTSINF KTLSFSVFEI ILITSLIGGG LLILIILTVA YGLKKPNKLT
560 570 580 590 600
HLCWPTVPNP AESSIATWHG DDFKDKLNLK ESDDSVNTED RILKPCSTPS
610 620 630 640 650
DKLVIDKLVV NFGNVLQEIF TDEARTGQEN NLGGEKNGYV TCPFRPDCPL
660 670 680 690 700
GKSFEELPVS PEIPPRKSQY LRSRMPEGTR PEAKEQLLFS GQSLVPDHLC
710 720 730
EEGAPNPYLK NSVTAREFLV SEKLPEHTKG EV
Length:732
Mass (Da):82,954
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i30F84BD3DD99A20E
GO
Isoform 2 (identifier: Q8NI17-2) [UniParc]FASTAAdd to basket
Also known as: v3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM

Show »
Length:764
Mass (Da):86,481
Checksum:iDC1D6BB2EA6AF15F
GO
Isoform 3 (identifier: Q8NI17-3) [UniParc]FASTAAdd to basket
Also known as: v4

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     639-649: YVTCPFRPDCP → TRILSSCPTSI
     650-732: Missing.

Show »
Length:662
Mass (Da):74,876
Checksum:iA49F6363C4B33582
GO
Isoform 4 (identifier: Q8NI17-4) [UniParc]FASTAAdd to basket
Also known as: v2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     325-732: Missing.

Show »
Length:356
Mass (Da):41,026
Checksum:iBF4DAD24F5048E1D
GO
Isoform 5 (identifier: Q8NI17-5) [UniParc]FASTAAdd to basket
Also known as: v1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     639-649: YVTCPFRPDCP → TRILSSCPTSI
     650-732: Missing.

Show »
Length:681
Mass (Da):77,047
Checksum:iC69CC4EF9AC55E42
GO
Isoform 6 (identifier: Q8NI17-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-110: Missing.

Note: No experimental confirmation available.
Show »
Length:622
Mass (Da):70,363
Checksum:i80E4A3592D040EC6
GO
Isoform 7 (identifier: Q8NI17-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     464-469: GGKGFS → A
     498-501: TSAG → YSGG
     502-732: Missing.

Note: No experimental confirmation available.
Show »
Length:509
Mass (Da):58,390
Checksum:i5DC85C59E170D44B
GO
Isoform 8 (identifier: Q8NI17-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     469-550: SKTVNSSILQ...YGLKKPNKLT → CKHAHSEVEK...RVLRKWKELL
     551-732: Missing.

Note: No experimental confirmation available.
Show »
Length:582
Mass (Da):66,605
Checksum:i5EC7B07B84B36057
GO
Isoform 9 (identifier: Q8NI17-9) [UniParc]FASTAAdd to basket
Also known as: GPL560, short

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     548-732: Missing.

Note: Major isoform. Dominant negative IL31 receptor.
Show »
Length:560
Mass (Da):63,638
Checksum:iBDE67D9F753AED29
GO
Isoform 10 (identifier: Q8NI17-10) [UniParc]FASTAAdd to basket
Also known as: GPL610

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     593-598: LKPCST → RARYQA
     599-732: Missing.

Show »
Length:611
Mass (Da):69,491
Checksum:iEE437BBA84162525
GO
Isoform 11 (identifier: Q8NI17-11) [UniParc]FASTAAdd to basket
Also known as: GPL626

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     593-613: LKPCSTPSDKLVIDKLVVNFG → KGSELGTKLKFKPLISLDCAF
     614-732: Missing.

Show »
Length:626
Mass (Da):71,023
Checksum:iFA80DED660647A2F
GO
Isoform 12 (identifier: Q8NI17-12) [UniParc]FASTAAdd to basket
Also known as: GPL745, long

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM

Note: Major isoform. Functional IL31 receptor.
Show »
Length:745
Mass (Da):84,309
Checksum:iC4A17642CCC0549B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGU4A0A0C4DGU4_HUMAN
Interleukin-31 receptor subunit alp...
IL31RA
324Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAS86444 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAS86445 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_030328155D → N. Corresponds to variant dbSNP:rs13184107Ensembl.1
Natural variantiVAR_065809489S → F in PLCA2. 1 Publication1
Natural variantiVAR_030329497S → N. Corresponds to variant dbSNP:rs161704Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0227981 – 110Missing in isoform 6. 1 PublicationAdd BLAST110
Alternative sequenceiVSP_0227991M → MCIRQLKFFTTACVCECPQN ILSPQPSCVNLGM in isoform 2, isoform 4, isoform 5 and isoform 8. 2 Publications1
Alternative sequenceiVSP_0228001M → MKLSPQPSCVNLGM in isoform 3, isoform 7, isoform 9, isoform 10, isoform 11 and isoform 12. 2 Publications1
Alternative sequenceiVSP_022801325 – 732Missing in isoform 4. 1 PublicationAdd BLAST408
Alternative sequenceiVSP_022802464 – 469GGKGFS → A in isoform 7. 1 Publication6
Alternative sequenceiVSP_022803469 – 550SKTVN…PNKLT → CKHAHSEVEKNPKPQIDAMD RPVVGMAPPSHCDLQPGMNH LASLNLSENGAKSTHLLGFW GLNESEVTVPERRVLRKWKE LL in isoform 8. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_022804498 – 501TSAG → YSGG in isoform 7. 1 Publication4
Alternative sequenceiVSP_022805502 – 732Missing in isoform 7. 1 PublicationAdd BLAST231
Alternative sequenceiVSP_022806548 – 732Missing in isoform 9. CuratedAdd BLAST185
Alternative sequenceiVSP_022807551 – 732Missing in isoform 8. 1 PublicationAdd BLAST182
Alternative sequenceiVSP_022808593 – 613LKPCS…VVNFG → KGSELGTKLKFKPLISLDCA F in isoform 11. CuratedAdd BLAST21
Alternative sequenceiVSP_022809593 – 598LKPCST → RARYQA in isoform 10. Curated6
Alternative sequenceiVSP_022810599 – 732Missing in isoform 10. CuratedAdd BLAST134
Alternative sequenceiVSP_022811614 – 732Missing in isoform 11. CuratedAdd BLAST119
Alternative sequenceiVSP_022812639 – 649YVTCPFRPDCP → TRILSSCPTSI in isoform 3 and isoform 5. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_022813650 – 732Missing in isoform 3 and isoform 5. 1 PublicationAdd BLAST83

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF486620 mRNA Translation: AAM27958.1
AY499339 mRNA Translation: AAS86444.1 Different initiation.
AY499340 mRNA Translation: AAS86445.1 Different initiation.
AY499341 mRNA Translation: AAS86446.1
AY499342 mRNA Translation: AAS86447.1
AF106913 mRNA Translation: AAL36452.1
AY358117 mRNA Translation: AAQ88484.1
AY358740 mRNA Translation: AAQ89100.1
AC008914 Genomic DNA No translation available.
BC110490 mRNA Translation: AAI10491.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3970.2 [Q8NI17-2]
CCDS56365.1 [Q8NI17-5]
CCDS56366.1 [Q8NI17-3]
CCDS56367.1 [Q8NI17-6]
CCDS75244.1 [Q8NI17-8]
CCDS75245.1 [Q8NI17-12]

NCBI Reference Sequences

More...
RefSeqi
NP_001229565.1, NM_001242636.1 [Q8NI17-12]
NP_001229566.1, NM_001242637.1 [Q8NI17-5]
NP_001229567.1, NM_001242638.1 [Q8NI17-3]
NP_001229568.1, NM_001242639.1 [Q8NI17-6]
NP_001284499.1, NM_001297570.1 [Q8NI17-8]
NP_001284501.1, NM_001297572.1
NP_620586.3, NM_139017.5 [Q8NI17-2]
XP_011541444.1, XM_011543142.2 [Q8NI17-1]
XP_011541445.1, XM_011543143.2 [Q8NI17-3]
XP_011541446.1, XM_011543144.2 [Q8NI17-6]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.55378

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000297015; ENSP00000297015; ENSG00000164509 [Q8NI17-12]
ENST00000354961; ENSP00000347047; ENSG00000164509 [Q8NI17-3]
ENST00000359040; ENSP00000351935; ENSG00000164509 [Q8NI17-5]
ENST00000396834; ENSP00000380046; ENSG00000164509 [Q8NI17-3]
ENST00000396836; ENSP00000380048; ENSG00000164509 [Q8NI17-8]
ENST00000447346; ENSP00000415900; ENSG00000164509 [Q8NI17-2]
ENST00000490985; ENSP00000427533; ENSG00000164509 [Q8NI17-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
133396

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:133396

UCSC genome browser

More...
UCSCi
uc003jqk.3 human [Q8NI17-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF486620 mRNA Translation: AAM27958.1
AY499339 mRNA Translation: AAS86444.1 Different initiation.
AY499340 mRNA Translation: AAS86445.1 Different initiation.
AY499341 mRNA Translation: AAS86446.1
AY499342 mRNA Translation: AAS86447.1
AF106913 mRNA Translation: AAL36452.1
AY358117 mRNA Translation: AAQ88484.1
AY358740 mRNA Translation: AAQ89100.1
AC008914 Genomic DNA No translation available.
BC110490 mRNA Translation: AAI10491.1
CCDSiCCDS3970.2 [Q8NI17-2]
CCDS56365.1 [Q8NI17-5]
CCDS56366.1 [Q8NI17-3]
CCDS56367.1 [Q8NI17-6]
CCDS75244.1 [Q8NI17-8]
CCDS75245.1 [Q8NI17-12]
RefSeqiNP_001229565.1, NM_001242636.1 [Q8NI17-12]
NP_001229566.1, NM_001242637.1 [Q8NI17-5]
NP_001229567.1, NM_001242638.1 [Q8NI17-3]
NP_001229568.1, NM_001242639.1 [Q8NI17-6]
NP_001284499.1, NM_001297570.1 [Q8NI17-8]
NP_001284501.1, NM_001297572.1
NP_620586.3, NM_139017.5 [Q8NI17-2]
XP_011541444.1, XM_011543142.2 [Q8NI17-1]
XP_011541445.1, XM_011543143.2 [Q8NI17-3]
XP_011541446.1, XM_011543144.2 [Q8NI17-6]
UniGeneiHs.55378

3D structure databases

ProteinModelPortaliQ8NI17
SMRiQ8NI17
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126357, 26 interactors
IntActiQ8NI17, 1 interactor
STRINGi9606.ENSP00000415900

Chemistry databases

GuidetoPHARMACOLOGYi1710

PTM databases

iPTMnetiQ8NI17
PhosphoSitePlusiQ8NI17

Polymorphism and mutation databases

BioMutaiIL31RA
DMDMi74730327

Proteomic databases

MaxQBiQ8NI17
PaxDbiQ8NI17
PeptideAtlasiQ8NI17
PRIDEiQ8NI17
ProteomicsDBi73801
73802 [Q8NI17-10]
73803 [Q8NI17-11]
73804 [Q8NI17-12]
73805 [Q8NI17-2]
73806 [Q8NI17-3]
73807 [Q8NI17-4]
73808 [Q8NI17-5]
73809 [Q8NI17-6]
73810 [Q8NI17-7]
73811 [Q8NI17-8]
73812 [Q8NI17-9]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297015; ENSP00000297015; ENSG00000164509 [Q8NI17-12]
ENST00000354961; ENSP00000347047; ENSG00000164509 [Q8NI17-3]
ENST00000359040; ENSP00000351935; ENSG00000164509 [Q8NI17-5]
ENST00000396834; ENSP00000380046; ENSG00000164509 [Q8NI17-3]
ENST00000396836; ENSP00000380048; ENSG00000164509 [Q8NI17-8]
ENST00000447346; ENSP00000415900; ENSG00000164509 [Q8NI17-2]
ENST00000490985; ENSP00000427533; ENSG00000164509 [Q8NI17-6]
GeneIDi133396
KEGGihsa:133396
UCSCiuc003jqk.3 human [Q8NI17-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
133396
DisGeNETi133396
EuPathDBiHostDB:ENSG00000164509.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IL31RA
HGNCiHGNC:18969 IL31RA
HPAiHPA051532
HPA068114
MalaCardsiIL31RA
MIMi609510 gene
613955 phenotype
neXtProtiNX_Q8NI17
OpenTargetsiENSG00000164509
Orphaneti353220 Familial primary localized cutaneous amyloidosis
PharmGKBiPA134952624

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJG6 Eukaryota
ENOG410YAI2 LUCA
GeneTreeiENSGT00940000155603
HOVERGENiHBG081788
InParanoidiQ8NI17
KOiK22630
OMAiCTWSPEK
OrthoDBi144839at2759
PhylomeDBiQ8NI17
TreeFamiTF338122

Enzyme and pathway databases

ReactomeiR-HSA-6788467 IL-6-type cytokine receptor ligand interactions
SignaLinkiQ8NI17
SIGNORiQ8NI17

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IL31RA human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
IL31RA

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
133396

Protein Ontology

More...
PROi
PR:Q8NI17

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164509 Expressed in 82 organ(s), highest expression level in thoracic aorta
ExpressionAtlasiQ8NI17 baseline and differential
GenevisibleiQ8NI17 HS

Family and domain databases

CDDicd00063 FN3, 2 hits
Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR015321 TypeI_recpt_CBD
PfamiView protein in Pfam
PF00041 fn3, 2 hits
PF09240 IL6Ra-bind, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 4 hits
SUPFAMiSSF49265 SSF49265, 3 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIL31R_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NI17
Secondary accession number(s): A6NIF8
, Q2TBA1, Q6EBC3, Q6EBC4, Q6EBC5, Q6EBC6, Q6UWL8, Q8WYJ0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 1, 2002
Last modified: February 13, 2019
This is version 140 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again