Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 161 (16 Oct 2019)
Sequence version 3 (17 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

InaD-like protein

Gene

PATJ

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Scaffolding protein that may bring different proteins into adjacent positions at the cell membrane (Probable). May regulate protein targeting, cell polarity and integrity of tight junctions (PubMed:11927608, PubMed:16678097). May regulate the surface expression and/or function of ASIC3 in sensory neurons (By similarity). May recruit ARHGEF18 to apical cell-cell boundaries (PubMed:22006950).By similarity1 Publication3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • bicellular tight junction assembly Source: Reactome
  • intracellular signal transduction Source: UniProtKB

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-420029 Tight junction interactions

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8NI35

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8NI35

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
InaD-like protein
Short name:
Inadl protein
Short name:
hINADL1 Publication
Alternative name(s):
Channel-interacting PDZ domain-containing proteinBy similarity
Pals1-associated tight junction protein1 Publication
Protein associated to tight junctions1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PATJ1 PublicationImported
Synonyms:CIPPBy similarity, INADL1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28881 PATJ

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603199 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NI35

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Tight junction

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi19L → W: Reduces L27 domain binding affinity to MPP5 L27 domain. 1 Publication1
Mutagenesisi38F → W: Reduces L27 domain binding affinity to MPP5 L27 domain. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
10207

Open Targets

More...
OpenTargetsi
ENSG00000132849

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134919267

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NI35

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PATJ

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242542

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945921 – 1801InaD-like proteinAdd BLAST1801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei455PhosphoserineCombined sources1
Modified residuei459PhosphoserineCombined sources1
Modified residuei522PhosphoserineCombined sources1
Modified residuei645PhosphoserineCombined sources1
Modified residuei1209PhosphothreonineCombined sources1
Modified residuei1212PhosphoserineCombined sources1
Modified residuei1508PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8NI35

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8NI35

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NI35

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NI35

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NI35

PeptideAtlas

More...
PeptideAtlasi
Q8NI35

PRoteomics IDEntifications database

More...
PRIDEi
Q8NI35

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
73822 [Q8NI35-1]
73823 [Q8NI35-2]
73824 [Q8NI35-3]
73825 [Q8NI35-4]
73826 [Q8NI35-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NI35

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NI35

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in renal tubules (at protein level) (PubMed:19755384). Expressed in bladder, testis, ovary, small intestine, colon, heart, skeletal muscle, pancreas and cerebellum in the brain.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000132849 Expressed in 214 organ(s), highest expression level in cerebellar vermis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NI35 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NI35 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA066352
HPA066960
HPA069079

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a ternary complex with MPP5, CRB1 and CRB3 (PubMed:11927608, PubMed:11964389).

Component of a complex whose core is composed of ARHGAP17, AMOT, MPP5/PALS1, INADL/PATJ and PARD3/PAR3 (PubMed:16678097).

Forms a heterotrimeric complex composed of MMP5, LIN7B and PATJ; the N-terminal L27 domain of MPP5 interacts with the L27 domain of PATJ and the C-terminal L27 domain of MPP5 interacts with the L27 domain of LIN7B (By similarity).

Interacts with TJP3/ZO-3 and CLDN1/claudin-1 (PubMed:12021270).

Interacts with ASIC3, KCNJ10, KCNJ15, GRIN2A, GRIN2B, GRIN2C, GRIN2D, NLGN2, HTR2A and SLC6A4 (By similarity).

Interacts with MPP7 (PubMed:12021270). Directly interacts with HTR4 (By similarity).

Interacts (via PDZ domain 8) with WWC1 (via the ADDV motif) (PubMed:18596123).

Interacts with SLC6A4 (By similarity).

Interacts (via C-terminus) with ARHGEF18 (PubMed:22006950).

Interacts with NPHP1 (PubMed:19755384).

By similarity7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115502, 46 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8NI35

Protein interaction database and analysis system

More...
IntActi
Q8NI35, 63 interactors

Molecular INTeraction database

More...
MINTi
Q8NI35

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000360200

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8NI35

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8NI35

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 65L27PROSITE-ProRule annotationAdd BLAST65
Domaini134 – 221PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini248 – 328PDZ 2PROSITE-ProRule annotationAdd BLAST81
Domaini365 – 453PDZ 3PROSITE-ProRule annotationAdd BLAST89
Domaini553 – 639PDZ 4PROSITE-ProRule annotationAdd BLAST87
Domaini686 – 772PDZ 5PROSITE-ProRule annotationAdd BLAST87
Domaini1068 – 1160PDZ 6PROSITE-ProRule annotationAdd BLAST93
Domaini1239 – 1322PDZ 7PROSITE-ProRule annotationAdd BLAST84
Domaini1437 – 1520PDZ 8PROSITE-ProRule annotationAdd BLAST84
Domaini1533 – 1615PDZ 9PROSITE-ProRule annotationAdd BLAST83
Domaini1676 – 1762PDZ 10PROSITE-ProRule annotationAdd BLAST87

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The L27 domain (also called Maguk recruitment domain) is required for interaction with MPP5 and CRB3, and MPP5 localization to tight junctions.1 Publication
The PDZ domain 6 mediates interaction with the C-terminus of TJP3 and is crucial for localization to the tight junctions (PubMed:12021270). The PDZ domain 8 interacts with CLDN1 but is not required for proper localization (PubMed:12021270).1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0708 Eukaryota
KOG3528 Eukaryota
ENOG4110362 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155136

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NI35

Identification of Orthologs from Complete Genome Data

More...
OMAi
ELLEXNE

Database of Orthologous Groups

More...
OrthoDBi
1419918at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NI35

TreeFam database of animal gene trees

More...
TreeFami
TF330709

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015132 L27_2
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09045 L27_2, 1 hit
PF00595 PDZ, 10 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00569 L27, 1 hit
SM00228 PDZ, 10 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101288 SSF101288, 1 hit
SSF50156 SSF50156, 10 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51022 L27, 1 hit
PS50106 PDZ, 10 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NI35-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPENPATDKL QVLQVLDRLK MKLQEKGDTS QNEKLSMFYE TLKSPLFNQI
60 70 80 90 100
LTLQQSIKQL KGQLNHIPSD CSANFDFSRK GLLVFTDGSI TNGNVHRPSN
110 120 130 140 150
NSTVSGLFPW TPKLGNEDFN SVIQQMAQGR QIEYIDIERP STGGLGFSVV
160 170 180 190 200
ALRSQNLGKV DIFVKDVQPG SVADRDQRLK ENDQILAINH TPLDQNISHQ
210 220 230 240 250
QAIALLQQTT GSLRLIVARE PVHTKSSTSS SLNDTTLPET VCWGHVEEVE
260 270 280 290 300
LINDGSGLGF GIVGGKTSGV VVRTIVPGGL ADRDGRLQTG DHILKIGGTN
310 320 330 340 350
VQGMTSEQVA QVLRNCGNSV RMLVARDPAG DISVTPPAPA ALPVALPTVA
360 370 380 390 400
SKGPGSDSSL FETYNVELVR KDGQSLGIRI VGYVGTSHTG EASGIYVKSI
410 420 430 440 450
IPGSAAYHNG HIQVNDKIVA VDGVNIQGFA NHDVVEVLRN AGQVVHLTLV
460 470 480 490 500
RRKTSSSTSP LEPPSDRGTV VEPLKPPALF LTGAVETETN VDGEDEEIKE
510 520 530 540 550
RIDTLKNDNI QALEKLEKVP DSPENELKSR WENLLGPDYE VMVATLDTQI
560 570 580 590 600
ADDAELQKYS KLLPIHTLRL GVEVDSFDGH HYISSIVSGG PVDTLGLLQP
610 620 630 640 650
EDELLEVNGM QLYGKSRREA VSFLKEVPPP FTLVCCRRLF DDEASVDEPR
660 670 680 690 700
RTETSLPETE VDHNMDVNTE EDDDGELALW SPEVKIVELV KDCKGLGFSI
710 720 730 740 750
LDYQDPLDPT RSVIVIRSLV ADGVAERSGG LLPGDRLVSV NEYCLDNTSL
760 770 780 790 800
AEAVEILKAV PPGLVHLGIC KPLVEDNEEE SCYILHSSSN EDKTEFSGTI
810 820 830 840 850
HDINSSLILE APKGFRDEPY FKEELVDEPF LDLGKSFHSQ QKEIEQSKEA
860 870 880 890 900
WEMHEFLTPR LQEMDEEREI LVDEEYELYQ DPSPSMELYP LSHIQEATPV
910 920 930 940 950
PSVNELHFGT QWLHDNEPSE SQEARTGRTV YSQEAQPYGY CPENVMKENF
960 970 980 990 1000
VMESLPSVPS TEGNSQQGRF DDLENLNSLA KTSLDLGMIP NDVQGPSLLI
1010 1020 1030 1040 1050
DLPVVAQRRE QEDLPLYQHQ ATRVISKASA YTGMLSSRYA TDTCELPERE
1060 1070 1080 1090 1100
EGEGEETPNF SHWGPPRIVE IFREPNVSLG ISIVGGQTVI KRLKNGEELK
1110 1120 1130 1140 1150
GIFIKQVLED SPAGKTNALK TGDKILEVSG VDLQNASHSE AVEAIKNAGN
1160 1170 1180 1190 1200
PVVFIVQSLS STPRVIPNVH NKANKITGNQ NQDTQEKKEK RQGTAPPPMK
1210 1220 1230 1240 1250
LPPPYKALTD DSDENEEEDA FTDQKIRQRY ADLPGELHII ELEKDKNGLG
1260 1270 1280 1290 1300
LSLAGNKDRS RMSIFVVGIN PEGPAAADGR MRIGDELLEI NNQILYGRSH
1310 1320 1330 1340 1350
QNASAIIKTA PSKVKLVFIR NEDAVNQMAV TPFPVPSSSP SSIEDQSGTE
1360 1370 1380 1390 1400
PISSEEDGSV EVGIKQLPES ESFKLAVSQM KQQKYPTKVS FSSQEIPLAP
1410 1420 1430 1440 1450
ASSYHSTDAD FTGYGGFQAP LSVDPATCPI VPGQEMIIEI SKGRSGLGLS
1460 1470 1480 1490 1500
IVGGKDTPLN AIVIHEVYEE GAAARDGRLW AGDQILEVNG VDLRNSSHEE
1510 1520 1530 1540 1550
AITALRQTPQ KVRLVVYRDE AHYRDEENLE IFPVDLQKKA GRGLGLSIVG
1560 1570 1580 1590 1600
KRNGSGVFIS DIVKGGAADL DGRLIQGDQI LSVNGEDMRN ASQETVATIL
1610 1620 1630 1640 1650
KCAQGLVQLE IGRLRAGSWT SARTTSQNSQ GSQQSAHSSC HPSFAPVITG
1660 1670 1680 1690 1700
LQNLVGTKRV SDPSQKNSGT DMEPRTVEIN RELSDALGIS IAGGRGSPLG
1710 1720 1730 1740 1750
DIPVFIAMIQ ASGVAARTQK LKVGDRIVSI NGQPLDGLSH ADVVNLLKNA
1760 1770 1780 1790 1800
YGRIILQVVA DTNISAIAAQ LENMSTGYHL GSPTAEHHPE DTEEQLQMTA

D
Length:1,801
Mass (Da):196,368
Last modified:October 17, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i313DD1F12B6AD80A
GO
Isoform 2 (identifier: Q8NI35-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1459-1459: L → LFWRLGSPRAWSQHLVRAFMLHHPVTEVEGQ
     1553-1801: Missing.

Show »
Length:1,582
Mass (Da):173,793
Checksum:i9444B48DB84DE81E
GO
Isoform 3 (identifier: Q8NI35-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1553-1801: Missing.

Show »
Length:1,552
Mass (Da):170,238
Checksum:i646145A57C61152A
GO
Isoform 4 (identifier: Q8NI35-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1460-1487: Missing.
     1553-1801: Missing.

Show »
Length:1,524
Mass (Da):167,159
Checksum:i5203884719B4B152
GO
Isoform 5 (identifier: Q8NI35-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-541: Missing.
     1631-1675: GSQQSAHSSC...KNSGTDMEPR → SAECTQQLSS...FRHRYGTKDC
     1676-1801: Missing.

Show »
Length:1,134
Mass (Da):125,231
Checksum:i2717B2D492419866
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WUZ6A0A087WUZ6_HUMAN
InaD-like protein
PATJ
1,182Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0X1KG69A0A0X1KG69_HUMAN
InaD-like protein
PATJ
1,181Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y549A0A2R8Y549_HUMAN
InaD-like protein
PATJ
1,882Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DE90B4DE90_HUMAN
InaD-like protein
PATJ
452Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQT2A0A0U1RQT2_HUMAN
InaD-like protein
PATJ
593Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RR46A0A0U1RR46_HUMAN
InaD-like protein
PATJ
683Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQW4A0A0U1RQW4_HUMAN
InaD-like protein
PATJ
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y5I3A0A2R8Y5I3_HUMAN
InaD-like protein
PATJ
666Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RRD7A0A0U1RRD7_HUMAN
InaD-like protein
PATJ
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQR3A0A0U1RQR3_HUMAN
InaD-like protein
PATJ
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1443G → R in CAA04666 (PubMed:9280290).Curated1
Sequence conflicti1699L → I in AAM28433 (PubMed:11927608).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_027988303G → R. Corresponds to variant dbSNP:rs3762321Ensembl.1
Natural variantiVAR_027989362E → A. Corresponds to variant dbSNP:rs1286823Ensembl.1
Natural variantiVAR_027990400I → V. Corresponds to variant dbSNP:rs7516332Ensembl.1
Natural variantiVAR_027991599Q → H. Corresponds to variant dbSNP:rs1286812Ensembl.1
Natural variantiVAR_022695744C → R1 PublicationCorresponds to variant dbSNP:rs1134764Ensembl.1
Natural variantiVAR_027992779E → K. Corresponds to variant dbSNP:rs12141598Ensembl.1
Natural variantiVAR_027993780E → K. Corresponds to variant dbSNP:rs12141599Ensembl.1
Natural variantiVAR_027994870I → M3 PublicationsCorresponds to variant dbSNP:rs2799627Ensembl.1
Natural variantiVAR_0279951178G → S1 PublicationCorresponds to variant dbSNP:rs1056513Ensembl.1
Natural variantiVAR_0279961282R → H2 PublicationsCorresponds to variant dbSNP:rs1134767Ensembl.1
Natural variantiVAR_0279971360V → L2 PublicationsCorresponds to variant dbSNP:rs2498982Ensembl.1
Natural variantiVAR_0279981504A → P. Corresponds to variant dbSNP:rs13376115Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0142041 – 541Missing in isoform 5. 1 PublicationAdd BLAST541
Alternative sequenceiVSP_0142051459L → LFWRLGSPRAWSQHLVRAFM LHHPVTEVEGQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_0142061460 – 1487Missing in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0142071553 – 1801Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_0142081631 – 1675GSQQS…DMEPR → SAECTQQLSSLLRSCHHWPA KPGWHKKSFRSFPEKFRHRY GTKDC in isoform 5. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0142091676 – 1801Missing in isoform 5. 1 PublicationAdd BLAST126

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ001306 mRNA Translation: CAA04666.1
AJ224747 mRNA Translation: CAA12112.1
AJ224748 mRNA Translation: CAA12113.1
AB044807 mRNA Translation: BAB19683.1
AF397170 mRNA Translation: AAM28433.1
AC097064 Genomic DNA No translation available.
AL136458 Genomic DNA No translation available.
AL353802 Genomic DNA No translation available.
AL449143 Genomic DNA No translation available.
AL590374 Genomic DNA No translation available.
BC021135 mRNA Translation: AAH21135.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS617.2 [Q8NI35-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000371158; ENSP00000360200; ENSG00000132849 [Q8NI35-1]
ENST00000484937; ENSP00000433669; ENSG00000132849 [Q8NI35-5]

UCSC genome browser

More...
UCSCi
uc001dab.4 human [Q8NI35-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001306 mRNA Translation: CAA04666.1
AJ224747 mRNA Translation: CAA12112.1
AJ224748 mRNA Translation: CAA12113.1
AB044807 mRNA Translation: BAB19683.1
AF397170 mRNA Translation: AAM28433.1
AC097064 Genomic DNA No translation available.
AL136458 Genomic DNA No translation available.
AL353802 Genomic DNA No translation available.
AL449143 Genomic DNA No translation available.
AL590374 Genomic DNA No translation available.
BC021135 mRNA Translation: AAH21135.1
CCDSiCCDS617.2 [Q8NI35-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1VF6X-ray2.10A/B9-67[»]
2D92NMR-A676-770[»]
2DAZNMR-A1219-1329[»]
2DB5NMR-A114-228[»]
2DLUNMR-A238-335[»]
2DM8NMR-A1425-1527[»]
2DMZNMR-A355-470[»]
2EHRNMR-A1058-1167[»]
4Q2NX-ray2.00A/B/C/D/E/F362-452[»]
6IRDX-ray2.81C1421-1625[»]
SMRiQ8NI35
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi115502, 46 interactors
CORUMiQ8NI35
IntActiQ8NI35, 63 interactors
MINTiQ8NI35
STRINGi9606.ENSP00000360200

PTM databases

iPTMnetiQ8NI35
PhosphoSitePlusiQ8NI35

Polymorphism and mutation databases

BioMutaiPATJ
DMDMi116242542

Proteomic databases

EPDiQ8NI35
jPOSTiQ8NI35
MassIVEiQ8NI35
MaxQBiQ8NI35
PaxDbiQ8NI35
PeptideAtlasiQ8NI35
PRIDEiQ8NI35
ProteomicsDBi73822 [Q8NI35-1]
73823 [Q8NI35-2]
73824 [Q8NI35-3]
73825 [Q8NI35-4]
73826 [Q8NI35-5]

Genome annotation databases

EnsembliENST00000371158; ENSP00000360200; ENSG00000132849 [Q8NI35-1]
ENST00000484937; ENSP00000433669; ENSG00000132849 [Q8NI35-5]
UCSCiuc001dab.4 human [Q8NI35-1]

Organism-specific databases

DisGeNETi10207

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PATJ
HGNCiHGNC:28881 PATJ
HPAiHPA066352
HPA066960
HPA069079
MIMi603199 gene
neXtProtiNX_Q8NI35
OpenTargetsiENSG00000132849
PharmGKBiPA134919267

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
KOG3528 Eukaryota
ENOG4110362 LUCA
GeneTreeiENSGT00940000155136
InParanoidiQ8NI35
OMAiELLEXNE
OrthoDBi1419918at2759
PhylomeDBiQ8NI35
TreeFamiTF330709

Enzyme and pathway databases

ReactomeiR-HSA-420029 Tight junction interactions
SignaLinkiQ8NI35
SIGNORiQ8NI35

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PATJ human
EvolutionaryTraceiQ8NI35

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
INADL
PharosiQ8NI35

Protein Ontology

More...
PROi
PR:Q8NI35

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000132849 Expressed in 214 organ(s), highest expression level in cerebellar vermis
ExpressionAtlasiQ8NI35 baseline and differential
GenevisibleiQ8NI35 HS

Family and domain databases

InterProiView protein in InterPro
IPR015132 L27_2
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
PfamiView protein in Pfam
PF09045 L27_2, 1 hit
PF00595 PDZ, 10 hits
SMARTiView protein in SMART
SM00569 L27, 1 hit
SM00228 PDZ, 10 hits
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50156 SSF50156, 10 hits
PROSITEiView protein in PROSITE
PS51022 L27, 1 hit
PS50106 PDZ, 10 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiINADL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NI35
Secondary accession number(s): O15249
, O43742, O60833, Q5VUA5, Q5VUA6, Q5VUA7, Q5VUA8, Q5VUA9, Q5VUB0, Q8WU78, Q9H3N9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: October 17, 2006
Last modified: October 16, 2019
This is version 161 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again