Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (31 Jul 2019)
Sequence version 2 (05 May 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Placental protein 13-like

Gene

LGALS14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis
LigandLectin

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Placental protein 13-like
Alternative name(s):
Charcot-Leyden crystal protein 2
Short name:
CLC2
Galectin-14
Short name:
Gal-14
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LGALS14
Synonyms:PPL13
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30054 LGALS14

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607260 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TCE9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
56891

Open Targets

More...
OpenTargetsi
ENSG00000006659

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134882378

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LGALS14

Domain mapping of disease mutations (DMDM)

More...
DMDMi
229462736

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000769641 – 139Placental protein 13-likeAdd BLAST139

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TCE9

PeptideAtlas

More...
PeptideAtlasi
Q8TCE9

PRoteomics IDEntifications database

More...
PRIDEi
Q8TCE9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
1919
74128 [Q8TCE9-1]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in placenta.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000006659 Expressed in 33 organ(s), highest expression level in chorionic villus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TCE9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TCE9 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121221, 17 interactors

Protein interaction database and analysis system

More...
IntActi
Q8TCE9, 48 interactors

Molecular INTeraction database

More...
MINTi
Q8TCE9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000353893

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8TCE9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 138GalectinPROSITE-ProRule annotationAdd BLAST133

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3587 Eukaryota
ENOG4111EA0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162909

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015090

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TCE9

KEGG Orthology (KO)

More...
KOi
K10097

Database of Orthologous Groups

More...
OrthoDBi
829777at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TCE9

TreeFam database of animal gene trees

More...
TreeFami
TF315551

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00070 GLECT, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR030652 Galectin_14
IPR001079 Galectin_CRD

The PANTHER Classification System

More...
PANTHERi
PTHR11346:SF92 PTHR11346:SF92, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00337 Gal-bind_lectin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00908 Gal-bind_lectin, 1 hit
SM00276 GLECT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51304 GALECTIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TCE9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSLPVPYTL PVSLPVGSCV IITGTPILTF VKDPQLEVNF YTGMDEDSDI
60 70 80 90 100
AFQFRLHFGH PAIMNSCVFG IWRYEEKCYY LPFEDGKPFE LCIYVRHKEY
110 120 130
KVMVNGQRIY NFAHRFPPAS VKMLQVFRDI SLTRVLISD
Length:139
Mass (Da):16,094
Last modified:May 5, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9B13695DB3C1E55A
GO
Isoform 2 (identifier: Q8TCE9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MSSLP → MSLTHRLHLCKYWGCAVSNVCRFWEGRPLPLMIV

Note: Gene prediction based on EST data.
Show »
Length:168
Mass (Da):19,578
Checksum:i70A5236771B917FF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R163M0R163_HUMAN
Galectin
LGALS14
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti3 – 6SLPV → ITPG in AAP97241 (Ref. 1) Curated4
Sequence conflicti13 – 14SL → PC in AAP97241 (Ref. 1) Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05524567C → R4 PublicationsCorresponds to variant dbSNP:rs4830Ensembl.1
Natural variantiVAR_055246127F → L4 PublicationsCorresponds to variant dbSNP:rs10755Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0470671 – 5MSSLP → MSLTHRLHLCKYWGCAVSNV CRFWEGRPLPLMIV in isoform 2. Curated5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF123762 mRNA Translation: AAP97241.1
AF267852 mRNA Translation: AAF78953.1
AF367430 mRNA Translation: AAK56284.1
AF367431 mRNA Translation: AAK56285.1
AF367432 mRNA Translation: AAK56286.1
FJ613341 mRNA Translation: ACR09643.1
FJ613342 mRNA Translation: ACR09644.1
AK312040 mRNA Translation: BAG34977.1
AC006133 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW56913.1
BC022257 mRNA Translation: AAH22257.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12542.1 [Q8TCE9-2]
CCDS46073.1 [Q8TCE9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_064514.1, NM_020129.2 [Q8TCE9-1]
NP_982297.1, NM_203471.1 [Q8TCE9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000360675; ENSP00000353893; ENSG00000006659 [Q8TCE9-2]
ENST00000392052; ENSP00000375905; ENSG00000006659 [Q8TCE9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56891

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56891

UCSC genome browser

More...
UCSCi
uc002omf.4 human [Q8TCE9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Galectin-13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF123762 mRNA Translation: AAP97241.1
AF267852 mRNA Translation: AAF78953.1
AF367430 mRNA Translation: AAK56284.1
AF367431 mRNA Translation: AAK56285.1
AF367432 mRNA Translation: AAK56286.1
FJ613341 mRNA Translation: ACR09643.1
FJ613342 mRNA Translation: ACR09644.1
AK312040 mRNA Translation: BAG34977.1
AC006133 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW56913.1
BC022257 mRNA Translation: AAH22257.1
CCDSiCCDS12542.1 [Q8TCE9-2]
CCDS46073.1 [Q8TCE9-1]
RefSeqiNP_064514.1, NM_020129.2 [Q8TCE9-1]
NP_982297.1, NM_203471.1 [Q8TCE9-2]

3D structure databases

SMRiQ8TCE9
ModBaseiSearch...

Protein-protein interaction databases

BioGridi121221, 17 interactors
IntActiQ8TCE9, 48 interactors
MINTiQ8TCE9
STRINGi9606.ENSP00000353893

Polymorphism and mutation databases

BioMutaiLGALS14
DMDMi229462736

Proteomic databases

PaxDbiQ8TCE9
PeptideAtlasiQ8TCE9
PRIDEiQ8TCE9
ProteomicsDBi1919
74128 [Q8TCE9-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
56891
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360675; ENSP00000353893; ENSG00000006659 [Q8TCE9-2]
ENST00000392052; ENSP00000375905; ENSG00000006659 [Q8TCE9-1]
GeneIDi56891
KEGGihsa:56891
UCSCiuc002omf.4 human [Q8TCE9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56891
DisGeNETi56891

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LGALS14
HGNCiHGNC:30054 LGALS14
MIMi607260 gene
neXtProtiNX_Q8TCE9
OpenTargetsiENSG00000006659
PharmGKBiPA134882378

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3587 Eukaryota
ENOG4111EA0 LUCA
GeneTreeiENSGT00940000162909
HOGENOMiHOG000015090
InParanoidiQ8TCE9
KOiK10097
OrthoDBi829777at2759
PhylomeDBiQ8TCE9
TreeFamiTF315551

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56891

Protein Ontology

More...
PROi
PR:Q8TCE9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000006659 Expressed in 33 organ(s), highest expression level in chorionic villus
ExpressionAtlasiQ8TCE9 baseline and differential
GenevisibleiQ8TCE9 HS

Family and domain databases

CDDicd00070 GLECT, 1 hit
InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR030652 Galectin_14
IPR001079 Galectin_CRD
PANTHERiPTHR11346:SF92 PTHR11346:SF92, 1 hit
PfamiView protein in Pfam
PF00337 Gal-bind_lectin, 1 hit
SMARTiView protein in SMART
SM00908 Gal-bind_lectin, 1 hit
SM00276 GLECT, 1 hit
SUPFAMiSSF49899 SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS51304 GALECTIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPPL13_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TCE9
Secondary accession number(s): A8MPV8
, B2R530, C5HZ19, Q7Z4X8, Q96KD4, Q96KD5, Q96KD6, Q9NR03
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: May 5, 2009
Last modified: July 31, 2019
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again