Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 123 (13 Nov 2019)
Sequence version 2 (20 Mar 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Elongator complex protein 5

Gene

ELP5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the RNA polymerase II elongator complex, a multiprotein complex associated with the RNA polymerase II (Pol II) holoenzyme, and which is involved in transcriptional elongation (PubMed:22854966). The elongator complex catalyzes formation of carboxymethyluridine in the wobble base at position 34 in tRNAs (PubMed:29332244). Involved in cell migration (By similarity). May be involved in TP53-mediated transcriptional regulation (PubMed:16850183).1 PublicationBy similarity2 Publications

Caution

It is uncertain whether Met-1 or Met-17 is the initiator.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis

This protein is involved in the pathway 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis, which is part of tRNA modification.1 Publication
View all proteins of this organism that are known to be involved in the pathway 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis and in tRNA modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranscription, Transcription regulation, tRNA processing

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3214847 HATs acetylate histones

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00988

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Elongator complex protein 51 Publication
Alternative name(s):
Dermal papilla-derived protein 61 Publication
S-phase 2 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ELP51 PublicationImported
Synonyms:C17orf81, DERP61 Publication
ORF Names:HSPC002, MSTP071
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30617 ELP5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615019 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8TE02

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23587

Open Targets

More...
OpenTargetsi
ENSG00000170291

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485405

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8TE02

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ELP5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
134034093

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002808171 – 316Elongator complex protein 5Add BLAST316

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei268PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8TE02

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8TE02

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8TE02

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8TE02

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8TE02

PeptideAtlas

More...
PeptideAtlasi
Q8TE02

PRoteomics IDEntifications database

More...
PRIDEi
Q8TE02

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74381 [Q8TE02-1]
74382 [Q8TE02-2]
74383 [Q8TE02-3]
74384 [Q8TE02-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8TE02

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8TE02

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed with high levels in heart, brain, liver, skeletal muscle and testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000170291 Expressed in 213 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8TE02 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8TE02 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023279

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the RNA polymerase II elongator complex (Elongator), which consists of ELP1, STIP1/ELP2, ELP3, ELP4, ELP5 and ELP6; in the complex, is required for optimal binding of ELP3 to ELP4.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117122, 12 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1949 Elongator holoenzyme complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8TE02

Protein interaction database and analysis system

More...
IntActi
Q8TE02, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000379869

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ELP5 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IZJG Eukaryota
ENOG411201Y LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009210

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000013029

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8TE02

Identification of Orthologs from Complete Genome Data

More...
OMAi
FRDPLSW

Database of Orthologous Groups

More...
OrthoDBi
805928at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8TE02

TreeFam database of animal gene trees

More...
TreeFami
TF314636

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019519 Elp5

The PANTHER Classification System

More...
PANTHERi
PTHR15641 PTHR15641, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10483 Elong_Iki1, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8TE02-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTPSEGARAG TGRELEMLDS LLALGGLVLL RDSVEWEGRS LLKALVKKSA
60 70 80 90 100
LCGEQVHILG CEVSEEEFRE GFDSDINNRL VYHDFFRDPL NWSKTEEAFP
110 120 130 140 150
GGPLGALRAM CKRTDPVPVT IALDSLSWLL LRLPCTTLCQ VLHAVSHQDS
160 170 180 190 200
CPGDSSSVGK VSVLGLLHEE LHGPGPVGAL SSLAQTEVTL GGTMGQASAH
210 220 230 240 250
ILCRRPRQRP TDQTQWFSIL PDFSLDLQEG PSVESQPYSD PHIPPVDPTT
260 270 280 290 300
HLTFNLHLSK KEREARDSLI LPFQFSSEKQ QALLRPRPGQ ATSHIFYEPD
310
AYDDLDQEDP DDDLDI
Length:316
Mass (Da):34,841
Last modified:March 20, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC96F86C6B99CE7CE
GO
Isoform 2 (identifier: Q8TE02-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-316: DPTTHLTFNL...QEDPDDDLDI → SKNAKARTRKCSLVSGHGRENKSCRGWGWGQGF

Show »
Length:279
Mass (Da):30,349
Checksum:i8178D41F211E8004
GO
Isoform 3 (identifier: Q8TE02-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-179: DSSSVGKVSVLGLLHEELHGPGPVGA → ETPPSLFPLIHLPLPRSVPLFLSTLE
     180-316: Missing.

Show »
Length:179
Mass (Da):19,719
Checksum:iD4FD6EDBB859EF3C
GO
Isoform 4 (identifier: Q8TE02-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     246-246: V → VHPLYLQV

Show »
Length:323
Mass (Da):35,692
Checksum:i085D33C458297F9A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L437I3L437_HUMAN
Elongator complex protein 5
ELP5
245Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1Q3I3L1Q3_HUMAN
Elongator complex protein 5
ELP5
262Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L3N8I3L3N8_HUMAN
Elongator complex protein 5
ELP5
230Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2T0I3L2T0_HUMAN
Elongator complex protein 5
ELP5
209Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L200I3L200_HUMAN
Elongator complex protein 5
ELP5
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1A8I3L1A8_HUMAN
Elongator complex protein 5
ELP5
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2A9I3L2A9_HUMAN
Elongator complex protein 5
ELP5
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3NI50I3NI50_HUMAN
Elongator complex protein 5
ELP5
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD20964 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAQ13591 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti151C → R in AAM10496 (PubMed:16850183).Curated1
Sequence conflicti175G → S in AAM10496 (PubMed:16850183).Curated1
Sequence conflicti181S → N in AAM10496 (PubMed:16850183).Curated1
Sequence conflicti228Q → K in AAM10496 (PubMed:16850183).Curated1
Sequence conflicti245P → R in AAM10496 (PubMed:16850183).Curated1
Isoform 2 (identifier: Q8TE02-2)
Sequence conflicti263H → Q in AAQ13591 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05388214E → K1 PublicationCorresponds to variant dbSNP:rs2521988Ensembl.1
Natural variantiVAR_031205303D → Y1 PublicationCorresponds to variant dbSNP:rs17849664Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_023920154 – 179DSSSV…GPVGA → ETPPSLFPLIHLPLPRSVPL FLSTLE in isoform 3. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_023921180 – 316Missing in isoform 3. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_023922246V → VHPLYLQV in isoform 4. 1 Publication1
Alternative sequenceiVSP_023923247 – 316DPTTH…DDLDI → SKNAKARTRKCSLVSGHGRE NKSCRGWGWGQGF in isoform 2. 2 PublicationsAdd BLAST70

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF087868 mRNA Translation: AAM10496.1
AB013910 mRNA Translation: BAB87800.1
AK289940 mRNA Translation: BAF82629.1
AC003688 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90230.1
CH471108 Genomic DNA Translation: EAW90231.1
BC002762 mRNA Translation: AAH02762.2
AF070658 mRNA Translation: AAD20964.1 Different initiation.
AF163262 mRNA Translation: AAQ13591.1 Different initiation.
AL713741 mRNA Translation: CAH56280.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11094.1 [Q8TE02-1]
CCDS11095.1 [Q8TE02-2]

NCBI Reference Sequences

More...
RefSeqi
NP_056177.3, NM_015362.4 [Q8TE02-1]
NP_981958.1, NM_203413.2 [Q8TE02-2]
NP_981959.1, NM_203414.2 [Q8TE02-1]
NP_981960.1, NM_203415.2 [Q8TE02-1]
XP_011522081.1, XM_011523779.2 [Q8TE02-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000354429; ENSP00000346412; ENSG00000170291 [Q8TE02-1]
ENST00000356683; ENSP00000349111; ENSG00000170291 [Q8TE02-2]
ENST00000396627; ENSP00000379868; ENSG00000170291 [Q8TE02-1]
ENST00000396628; ENSP00000379869; ENSG00000170291 [Q8TE02-1]
ENST00000573657; ENSP00000459633; ENSG00000170291 [Q8TE02-3]
ENST00000574255; ENSP00000461489; ENSG00000170291 [Q8TE02-3]
ENST00000574993; ENSP00000459835; ENSG00000170291 [Q8TE02-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23587

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23587

UCSC genome browser

More...
UCSCi
uc002gfg.2 human [Q8TE02-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087868 mRNA Translation: AAM10496.1
AB013910 mRNA Translation: BAB87800.1
AK289940 mRNA Translation: BAF82629.1
AC003688 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90230.1
CH471108 Genomic DNA Translation: EAW90231.1
BC002762 mRNA Translation: AAH02762.2
AF070658 mRNA Translation: AAD20964.1 Different initiation.
AF163262 mRNA Translation: AAQ13591.1 Different initiation.
AL713741 mRNA Translation: CAH56280.1
CCDSiCCDS11094.1 [Q8TE02-1]
CCDS11095.1 [Q8TE02-2]
RefSeqiNP_056177.3, NM_015362.4 [Q8TE02-1]
NP_981958.1, NM_203413.2 [Q8TE02-2]
NP_981959.1, NM_203414.2 [Q8TE02-1]
NP_981960.1, NM_203415.2 [Q8TE02-1]
XP_011522081.1, XM_011523779.2 [Q8TE02-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi117122, 12 interactors
ComplexPortaliCPX-1949 Elongator holoenzyme complex
CORUMiQ8TE02
IntActiQ8TE02, 7 interactors
STRINGi9606.ENSP00000379869

PTM databases

iPTMnetiQ8TE02
PhosphoSitePlusiQ8TE02

Polymorphism and mutation databases

BioMutaiELP5
DMDMi134034093

Proteomic databases

EPDiQ8TE02
jPOSTiQ8TE02
MassIVEiQ8TE02
MaxQBiQ8TE02
PaxDbiQ8TE02
PeptideAtlasiQ8TE02
PRIDEiQ8TE02
ProteomicsDBi74381 [Q8TE02-1]
74382 [Q8TE02-2]
74383 [Q8TE02-3]
74384 [Q8TE02-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
23587

Genome annotation databases

EnsembliENST00000354429; ENSP00000346412; ENSG00000170291 [Q8TE02-1]
ENST00000356683; ENSP00000349111; ENSG00000170291 [Q8TE02-2]
ENST00000396627; ENSP00000379868; ENSG00000170291 [Q8TE02-1]
ENST00000396628; ENSP00000379869; ENSG00000170291 [Q8TE02-1]
ENST00000573657; ENSP00000459633; ENSG00000170291 [Q8TE02-3]
ENST00000574255; ENSP00000461489; ENSG00000170291 [Q8TE02-3]
ENST00000574993; ENSP00000459835; ENSG00000170291 [Q8TE02-2]
GeneIDi23587
KEGGihsa:23587
UCSCiuc002gfg.2 human [Q8TE02-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23587
DisGeNETi23587

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ELP5
HGNCiHGNC:30617 ELP5
HPAiHPA023279
MIMi615019 gene
neXtProtiNX_Q8TE02
OpenTargetsiENSG00000170291
PharmGKBiPA143485405

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IZJG Eukaryota
ENOG411201Y LUCA
GeneTreeiENSGT00390000009210
HOGENOMiHOG000013029
InParanoidiQ8TE02
OMAiFRDPLSW
OrthoDBi805928at2759
PhylomeDBiQ8TE02
TreeFamiTF314636

Enzyme and pathway databases

UniPathwayiUPA00988
ReactomeiR-HSA-3214847 HATs acetylate histones

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ELP5 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
C17orf81

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23587
PharosiQ8TE02

Protein Ontology

More...
PROi
PR:Q8TE02

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000170291 Expressed in 213 organ(s), highest expression level in right testis
ExpressionAtlasiQ8TE02 baseline and differential
GenevisibleiQ8TE02 HS

Family and domain databases

InterProiView protein in InterPro
IPR019519 Elp5
PANTHERiPTHR15641 PTHR15641, 1 hit
PfamiView protein in Pfam
PF10483 Elong_Iki1, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiELP5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8TE02
Secondary accession number(s): A8K1M5
, D3DTN9, Q659B6, Q7Z2T4, Q8TDR9, Q9BUB2, Q9Y2Q4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: November 13, 2019
This is version 123 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again