Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (31 Jul 2019)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Intraflagellar transport protein 81 homolog

Gene

IFT81

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the intraflagellar transport (IFT) complex B: together with IFT74, forms a tubulin-binding module that specifically mediates transport of tubulin within the cilium. Binds tubulin via its CH (calponin-homology)-like region (PubMed:23990561). Required for ciliogenesis (PubMed:27666822, PubMed:23990561). Required for proper regulation of SHH signaling (PubMed:27666822).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5620924 Intraflagellar transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Intraflagellar transport protein 81 homolog
Alternative name(s):
Carnitine deficiency-associated protein expressed in ventricle 1
Short name:
CDV-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IFT81
Synonyms:CDV1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14313 IFT81

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605489 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WYA0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Short-rib thoracic dysplasia 19 with or without polydactyly (SRTD19)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of short-rib thoracic dysplasia, a group of autosomal recessive ciliopathies that are characterized by a constricted thoracic cage, short ribs, shortened tubular bones, and a 'trident' appearance of the acetabular roof. Polydactyly is variably present. Non-skeletal involvement can include cleft lip/palate as well as anomalies of major organs such as the brain, eye, heart, kidneys, liver, pancreas, intestines, and genitalia. Some forms of the disease are lethal in the neonatal period due to respiratory insufficiency secondary to a severely restricted thoracic cage, whereas others are compatible with life. Disease spectrum encompasses Ellis-van Creveld syndrome, asphyxiating thoracic dystrophy (Jeune syndrome), Mainzer-Saldino syndrome, and short rib-polydactyly syndrome.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08048529L → F in SRTD19. 1 PublicationCorresponds to variant dbSNP:rs751222088EnsemblClinVar.1
Natural variantiVAR_080487262 – 676Missing in SRTD19. 1 PublicationAdd BLAST415
Natural variantiVAR_080793435Missing in SRTD19; unknown pathological significance. 1 Publication1
Natural variantiVAR_080488512 – 676Missing in SRTD19. 1 PublicationAdd BLAST165

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi73 – 75KYK → EYE: Abolishes tubulin-binding and impaired ciliogenesis; when associated with 113-E-E-114. 1 Publication3
Mutagenesisi113 – 114KK → EE: Abolishes tubulin-binding and impaired ciliogenesis; when associated with 73-E--E-75. 1 Publication2

Keywords - Diseasei

Ciliopathy, Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
28981

MalaCards human disease database

More...
MalaCardsi
IFT81
MIMi617895 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000122970

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26349

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IFT81

Domain mapping of disease mutations (DMDM)

More...
DMDMi
48474907

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000209162 – 676Intraflagellar transport protein 81 homologAdd BLAST675

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei61PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WYA0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8WYA0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WYA0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WYA0

PeptideAtlas

More...
PeptideAtlasi
Q8WYA0

PRoteomics IDEntifications database

More...
PRIDEi
Q8WYA0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75140 [Q8WYA0-1]
75141 [Q8WYA0-3]
75142 [Q8WYA0-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WYA0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WYA0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis, moderately in ovary, heart, liver, skeletal muscle, kidney and pancreas, low in prostate, brain, placenta and lung and not detected in spleen, thymus, small intestine and colon. Isoform CDV-1R is abundantly expressed in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000122970 Expressed in 206 organ(s), highest expression level in bronchial epithelial cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WYA0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WYA0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA019087
HPA020051

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the IFT complex B, at least composed of IFT20, IFT22, HSPB11/IFT25, IFT27, IFT46, IFT52, TRAF3IP1/IFT54, IFT57, IFT74, IFT80, IFT81, and IFT88 (PubMed:23990561).

Interacts with IFT74; the interaction is direct: within the IFT complex B, IFT74 and IFT81 mediate the transport of tubulin within the cilium (PubMed:15955805, PubMed:23990561).

Interacts with tubulin; the interaction is direct (PubMed:23990561).

Interacts with RABL2/RABL2A; binding is equal in the presence of GTP or GDP (By similarity).

Interacts with IFT88 (PubMed:23990561).

Interacts (via the IFT74/IFT81 heterodimer) with RABL2B (PubMed:28625565, PubMed:28428259).

By similarity4 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118802, 46 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8WYA0

Protein interaction database and analysis system

More...
IntActi
Q8WYA0, 29 interactors

Molecular INTeraction database

More...
MINTi
Q8WYA0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000242591

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WYA0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2 – 121CH (calponin-homology)-like regionAdd BLAST120

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili132 – 258Sequence analysisAdd BLAST127
Coiled coili306 – 389Sequence analysisAdd BLAST84
Coiled coili416 – 456Sequence analysisAdd BLAST41
Coiled coili490 – 622Sequence analysisAdd BLAST133

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The CH (calponin-homology)-like region shows high similarity to a CH (calponin-homology) domain and mediated binding to the globular domain of tubulin.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the IFT81 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHK2 Eukaryota
ENOG410XVNJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000999

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000237323

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WYA0

KEGG Orthology (KO)

More...
KOi
K19677

Identification of Orthologs from Complete Genome Data

More...
OMAi
HYTNCMI

Database of Orthologous Groups

More...
OrthoDBi
301582at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WYA0

TreeFam database of animal gene trees

More...
TreeFami
TF314635

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029600 IFT81
IPR041146 IFT81_CH

The PANTHER Classification System

More...
PANTHERi
PTHR15614 PTHR15614, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF18383 IFT81_CH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform CDV-1R2 Publications (identifier: Q8WYA0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDQIKFIMD SLNKEPFRKN YNLITFDSLE PMQLLQVLSD VLAEIDPKQL
60 70 80 90 100
VDIREEMPEQ TAKRMLSLLG ILKYKPSGNA TDMSTFRQGL VIGSKPVIYP
110 120 130 140 150
VLHWLLQRTN ELKKRAYLAR FLIKLEVPSE FLQDETVADT NKQYEELMEA
160 170 180 190 200
FKTLHKEYEQ LKISGFSTAE IRKDISAMEE EKDQLIKRVE HLKKRVETAQ
210 220 230 240 250
NHQWMLKIAR QLRVEKEREE YLAQQKQEQK NQLFHAVQRL QRVQNQLKSM
260 270 280 290 300
RQAAADAKPE SLMKRLEEEI KFNLYMVTEK FPKELENKKK ELHFLQKVVS
310 320 330 340 350
EPAMGHSDLL ELESKINEIN TEINQLIEKK MMRNEPIEGK LSLYRQQASI
360 370 380 390 400
ISRKKEAKAE ELQEAKEKLA SLEREASVKR NQTREFDGTE VLKGDEFKRY
410 420 430 440 450
VNKLRSKSTV FKKKHQIIAE LKAEFGLLQR TEELLKQRHE NIQQQLQTME
460 470 480 490 500
EKKGISGYSY TQEELERVSA LKSEVDEMKG RTLDDMSEMV KKLYSLVSEK
510 520 530 540 550
KSALASVIKE LRQLRQKYQE LTQECDEKKS QYDSCAAGLE SNRSKLEQEV
560 570 580 590 600
RRLREECLQE ESRYHYTNCM IKNLEVQLRR ATDEMKAYIS SDQQEKRKAI
610 620 630 640 650
REQYTKNTAE QENLGKKLRE KQKVIRESHG PNMKQAKMWR DLEQLMECKK
660 670
QCFLKQQSQT SIGQVIQEGG EDRLIL
Length:676
Mass (Da):79,746
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE5EBD887A6BF953E
GO
Isoform 2Curated (identifier: Q8WYA0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-431: FKRYVNKLRSKSTVFKKKHQIIAELKAEFGLLQRT → RQDLTLSPRLECGGVIMAYCSLKLLGSSDPPTSAS
     432-676: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:431
Mass (Da):50,241
Checksum:iD6C78C86420CE32C
GO
Isoform CDV-1 (identifier: Q8WYA0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-569: Missing.

Note: Produced by alternative initiation at Met-570 of isoform CDV-1R.
Show »
Length:107
Mass (Da):12,667
Checksum:i2721396F751403AC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W1J4F8W1J4_HUMAN
Intraflagellar transport protein 81...
IFT81
366Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHE2H0YHE2_HUMAN
Intraflagellar transport protein 81...
IFT81
624Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIR4H0YIR4_HUMAN
Intraflagellar transport protein 81...
IFT81
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti59E → K in BAC03690 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08048529L → F in SRTD19. 1 PublicationCorresponds to variant dbSNP:rs751222088EnsemblClinVar.1
Natural variantiVAR_080487262 – 676Missing in SRTD19. 1 PublicationAdd BLAST415
Natural variantiVAR_080793435Missing in SRTD19; unknown pathological significance. 1 Publication1
Natural variantiVAR_080488512 – 676Missing in SRTD19. 1 PublicationAdd BLAST165

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0187841 – 569Missing in isoform CDV-1. 2 PublicationsAdd BLAST569
Alternative sequenceiVSP_050695397 – 431FKRYV…LLQRT → RQDLTLSPRLECGGVIMAYC SLKLLGSSDPPTSAS in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_050696432 – 676Missing in isoform 2. 1 PublicationAdd BLAST245

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF250326 mRNA Translation: AAL50343.1
AF332010 mRNA Translation: AAO32947.1
AF139540 mRNA Translation: AAP97269.1
AF078932 mRNA Translation: AAD48091.1
CH471054 Genomic DNA Translation: EAW97898.1
BC004536 mRNA Translation: AAH04536.2
BC029349 mRNA Translation: AAH29349.1
BC108257 mRNA Translation: AAI08258.1
AK091549 mRNA Translation: BAC03690.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41831.1 [Q8WYA0-1]
CCDS9142.1 [Q8WYA0-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001137251.1, NM_001143779.1 [Q8WYA0-1]
NP_001334875.1, NM_001347946.1 [Q8WYA0-3]
NP_054774.2, NM_014055.3 [Q8WYA0-1]
NP_113661.2, NM_031473.3 [Q8WYA0-3]
XP_016874706.1, XM_017019217.1 [Q8WYA0-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
28981

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:28981

UCSC genome browser

More...
UCSCi
uc001tqh.4 human [Q8WYA0-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF250326 mRNA Translation: AAL50343.1
AF332010 mRNA Translation: AAO32947.1
AF139540 mRNA Translation: AAP97269.1
AF078932 mRNA Translation: AAD48091.1
CH471054 Genomic DNA Translation: EAW97898.1
BC004536 mRNA Translation: AAH04536.2
BC029349 mRNA Translation: AAH29349.1
BC108257 mRNA Translation: AAI08258.1
AK091549 mRNA Translation: BAC03690.1 Sequence problems.
CCDSiCCDS41831.1 [Q8WYA0-1]
CCDS9142.1 [Q8WYA0-3]
RefSeqiNP_001137251.1, NM_001143779.1 [Q8WYA0-1]
NP_001334875.1, NM_001347946.1 [Q8WYA0-3]
NP_054774.2, NM_014055.3 [Q8WYA0-1]
NP_113661.2, NM_031473.3 [Q8WYA0-3]
XP_016874706.1, XM_017019217.1 [Q8WYA0-1]

3D structure databases

SMRiQ8WYA0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi118802, 46 interactors
CORUMiQ8WYA0
IntActiQ8WYA0, 29 interactors
MINTiQ8WYA0
STRINGi9606.ENSP00000242591

PTM databases

iPTMnetiQ8WYA0
PhosphoSitePlusiQ8WYA0

Polymorphism and mutation databases

BioMutaiIFT81
DMDMi48474907

Proteomic databases

EPDiQ8WYA0
jPOSTiQ8WYA0
MaxQBiQ8WYA0
PaxDbiQ8WYA0
PeptideAtlasiQ8WYA0
PRIDEiQ8WYA0
ProteomicsDBi75140 [Q8WYA0-1]
75141 [Q8WYA0-3]
75142 [Q8WYA0-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
28981
Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi28981
KEGGihsa:28981
UCSCiuc001tqh.4 human [Q8WYA0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
28981
DisGeNETi28981

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IFT81
HGNCiHGNC:14313 IFT81
HPAiHPA019087
HPA020051
MalaCardsiIFT81
MIMi605489 gene
617895 phenotype
neXtProtiNX_Q8WYA0
OpenTargetsiENSG00000122970
PharmGKBiPA26349

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IHK2 Eukaryota
ENOG410XVNJ LUCA
GeneTreeiENSGT00390000000999
HOGENOMiHOG000237323
InParanoidiQ8WYA0
KOiK19677
OMAiHYTNCMI
OrthoDBi301582at2759
PhylomeDBiQ8WYA0
TreeFamiTF314635

Enzyme and pathway databases

ReactomeiR-HSA-5620924 Intraflagellar transport

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IFT81 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
IFT81

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
28981

Protein Ontology

More...
PROi
PR:Q8WYA0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000122970 Expressed in 206 organ(s), highest expression level in bronchial epithelial cell
ExpressionAtlasiQ8WYA0 baseline and differential
GenevisibleiQ8WYA0 HS

Family and domain databases

InterProiView protein in InterPro
IPR029600 IFT81
IPR041146 IFT81_CH
PANTHERiPTHR15614 PTHR15614, 1 hit
PfamiView protein in Pfam
PF18383 IFT81_CH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIFT81_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WYA0
Secondary accession number(s): Q2YDY1
, Q8NB51, Q9BSV2, Q9UNY8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 1, 2002
Last modified: July 31, 2019
This is version 145 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again