Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (16 Oct 2019)
Sequence version 2 (25 Oct 2017)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Secretoglobin family 3A member 2

Gene

Scgb3a2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Secreted cytokine-like protein (By similarity). Binds to the scavenger receptor MARCO (By similarity). Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast (By similarity). Strongly inhibits phospholipase A2 (PLA2G1B) activity (PubMed:24213919). Seems to have anti-inflammatory effects in respiratory epithelium (PubMed:16456148, PubMed:25242865). Also has anti-fibrotic activity in lung (PubMed:24213919, PubMed:26559674). May play a role in fetal lung development and maturation (PubMed:18535256). Promotes branching morphogenesis during early stages of lung development (PubMed:18535256). In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) (PubMed:24514953).By similarity6 Publications

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-3000480 Scavenging by Class A Receptors

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Secretoglobin family 3A member 2
Alternative name(s):
Pneumo secretory protein 1
Short name:
PnSP-1
Uteroglobin-related protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Scgb3a2
Synonyms:Pnsp1, Ugrp1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2153470 Scgb3a2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Viable and fertile, with no gross abnormalities. Lung tissue appears normal (PubMed:25242865). In a C57BL/6NCr strain background, animals show a mild increase in ovalbumin-induced inflammatory response in lung (PubMed:25242865). However, in a mixed genetic background, there is a reduced ovalbumin-induced inflammatory response, possibly due to the presence of modifier genes (PubMed:25242865). Animals have a more severe response to bleomycin-induced pulmonary fibrosis characterized by increased weight loss, more extensive fibrosis in lung tissue, increased expression of collagen genes, higher numbers of lymphocyte, monocyte and neutrophil cells in bronchoalveolar lavage fluid, and increased cytokine levels (PubMed:26559674).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi68C → S: Fails to homodimerize. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21By similarityAdd BLAST21
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003638222 – 91Secretoglobin family 3A member 2Add BLAST70

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi68Interchain1 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q920H1

PRoteomics IDEntifications database

More...
PRIDEi
Q920H1

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q920H1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in lung where it localizes to epithelial cells of the trachea, bronchus and bronchioles (at protein level) (PubMed:11682631, PubMed:12406855, PubMed:12175512, PubMed:25242865). Expressed in club/Clara cells of the bronchioles (PubMed:12406855). Also detected in the anterior and posterior lobes of the pituitary gland where it may localize to gonadotropic cells (at protein level) (PubMed:24514953). Not detected in other tissues tested (PubMed:11682631, PubMed:12175512).5 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Detected in the pituitary gland from postnatal day 1 onwards (at protein level) (PubMed:24514953). Weakly expressed in embryonic lung at stages 11.5 dpc and 12.5 dpc (PubMed:11682631, PubMed:18535256). Seems to localize most strongly to the growing tips of bronchi at stage 13.5 dpc (PubMed:18535256). Highly expressed in developing lung at stages 16.5 dpc and 18.5 dpc, where it localizes to airway epithelia (PubMed:11682631, PubMed:12406855, PubMed:12175512, PubMed:24514953). During gestation, detected in the mammary gland at 6.5 days post coitum (dpc), but expression declines at 8.5 dpc and is absent at later stages (PubMed:12175512).5 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000038791 Expressed in 38 organ(s), highest expression level in right lung lobe

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q920H1 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked (PubMed:11682631, PubMed:24213919). Monomer (PubMed:11682631, PubMed:24213919).

Interacts with APOA1 (By similarity).

By similarity2 Publications

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000038872

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q920H1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the secretoglobin family. UGRP subfamily.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J1Y3 Eukaryota
ENOG4111402 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00420000029848

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000128185

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q920H1

Identification of Orthologs from Complete Genome Data

More...
OMAi
VTISVCS

Database of Orthologous Groups

More...
OrthoDBi
1615937at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q920H1

TreeFam database of animal gene trees

More...
TreeFami
TF336928

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016126 Secretoglobin
IPR040301 Secretoglobin_3A

The PANTHER Classification System

More...
PANTHERi
PTHR34829 PTHR34829, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01099 Uteroglobin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform A1 Publication (identifier: Q920H1-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLVSIFLLV TIGICGYSAT ALLINRLPVV DKLPVPLDDI IPSFDPLKML
60 70 80 90
LKTLGISVEH LVTGLKKCVD ELGPEASEAV KKLLEALSHL V
Note: Major isoform.1 Publication
Length:91
Mass (Da):9,819
Last modified:October 25, 2017 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2B5C4D39E6A4EE14
GO
Isoform B1 Publication (identifier: Q920H1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-84: L → LVIIICSYFPGRSLCYVNNLPSF

Show »
Length:113
Mass (Da):12,307
Checksum:iC25213F9BCB96F16
GO
Isoform C1 Publication (identifier: Q920H1-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     85-91: EALSHLV → VIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Show »
Length:139
Mass (Da):15,432
Checksum:i8A2FB080B41E65E4
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05918284L → LVIIICSYFPGRSLCYVNNL PSF in isoform B. 1 Publication1
Alternative sequenceiVSP_05918385 – 91EALSHLV → VIIICSYFPGRSLCYVNNLP SFVSVLFLPMICAYPRDSKK QTFAFIERVFEQSKL in isoform C. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF274959 mRNA Translation: AAL25708.1
AF274960 mRNA Translation: AAL25709.1
AF274961 mRNA Translation: AAL25710.1
AF439546 mRNA Translation: AAQ04561.1
AK136373 mRNA Translation: BAE22952.1
AK136396 mRNA Translation: BAE22961.1
CH466528 Genomic DNA Translation: EDL10011.1
BC061046 mRNA Translation: AAH61046.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS79640.1 [Q920H1-2]
CCDS79641.1 [Q920H1-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001276572.1, NM_001289643.1 [Q920H1-3]
NP_001276573.1, NM_001289644.1 [Q920H1-2]
XP_011245113.1, XM_011246811.1 [Q920H1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000043803; ENSMUSP00000038872; ENSMUSG00000038791 [Q920H1-1]
ENSMUST00000187157; ENSMUSP00000140476; ENSMUSG00000038791 [Q920H1-2]
ENSMUST00000189750; ENSMUSP00000140375; ENSMUSG00000038791 [Q920H1-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
117158

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:117158

UCSC genome browser

More...
UCSCi
uc008eum.2 mouse [Q920H1-2]
uc008eun.2 mouse
uc012bck.2 mouse [Q920H1-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274959 mRNA Translation: AAL25708.1
AF274960 mRNA Translation: AAL25709.1
AF274961 mRNA Translation: AAL25710.1
AF439546 mRNA Translation: AAQ04561.1
AK136373 mRNA Translation: BAE22952.1
AK136396 mRNA Translation: BAE22961.1
CH466528 Genomic DNA Translation: EDL10011.1
BC061046 mRNA Translation: AAH61046.1
CCDSiCCDS79640.1 [Q920H1-2]
CCDS79641.1 [Q920H1-3]
RefSeqiNP_001276572.1, NM_001289643.1 [Q920H1-3]
NP_001276573.1, NM_001289644.1 [Q920H1-2]
XP_011245113.1, XM_011246811.1 [Q920H1-1]

3D structure databases

SMRiQ920H1
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000038872

PTM databases

PhosphoSitePlusiQ920H1

Proteomic databases

PaxDbiQ920H1
PRIDEiQ920H1

Genome annotation databases

EnsembliENSMUST00000043803; ENSMUSP00000038872; ENSMUSG00000038791 [Q920H1-1]
ENSMUST00000187157; ENSMUSP00000140476; ENSMUSG00000038791 [Q920H1-2]
ENSMUST00000189750; ENSMUSP00000140375; ENSMUSG00000038791 [Q920H1-3]
GeneIDi117158
KEGGimmu:117158
UCSCiuc008eum.2 mouse [Q920H1-2]
uc008eun.2 mouse
uc012bck.2 mouse [Q920H1-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
117156
MGIiMGI:2153470 Scgb3a2

Phylogenomic databases

eggNOGiENOG410J1Y3 Eukaryota
ENOG4111402 LUCA
GeneTreeiENSGT00420000029848
HOGENOMiHOG000128185
InParanoidiQ920H1
OMAiVTISVCS
OrthoDBi1615937at2759
PhylomeDBiQ920H1
TreeFamiTF336928

Enzyme and pathway databases

ReactomeiR-MMU-3000480 Scavenging by Class A Receptors

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Scgb3a2 mouse

Protein Ontology

More...
PROi
PR:Q920H1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000038791 Expressed in 38 organ(s), highest expression level in right lung lobe
GenevisibleiQ920H1 MM

Family and domain databases

InterProiView protein in InterPro
IPR016126 Secretoglobin
IPR040301 Secretoglobin_3A
PANTHERiPTHR34829 PTHR34829, 1 hit
PfamiView protein in Pfam
PF01099 Uteroglobin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSG3A2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q920H1
Secondary accession number(s): Q5D060, Q920H2, Q920H3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: October 25, 2017
Last modified: October 16, 2019
This is version 120 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again