Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (18 Sep 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Glutamate receptor-interacting protein 1

Gene

Grip1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons (By similarity). Through complex formation with NSG1, GRIA2 and STX12 controls the intracellular fate of AMPAR and the endosomal sorting of the GRIA2 subunit toward recycling and membrane targeting (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-416993 Trafficking of GluR2-containing AMPA receptors

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glutamate receptor-interacting protein 1
Short name:
GRIP-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Grip1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1921303 Grip1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000838501 – 1127Glutamate receptor-interacting protein 1Add BLAST1127

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei43PhosphoserineBy similarity1
Isoform 2 (identifier: Q925T6-2)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi11S-palmitoyl cysteine1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylation of isoform 2.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q925T6

PRoteomics IDEntifications database

More...
PRIDEi
Q925T6

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q925T6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q925T6

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q925T6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain. Isoform 2 is the major isoform in brain. Expressed in oligodendrocyte lineage cells.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Detected in early development between postnatal days 3 (P3) and P8 and decreased from P14 in forebrain and cerebellum.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000034813 Expressed in 212 organ(s), highest expression level in rostral migratory stream

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q925T6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q925T6 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EFNB3, GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PTPRF, liprins-alpha and the C-terminal tail of PRLHR. Can form homomultimers or heteromultimers with GRIP2 (By similarity).

Interacts with EFNB1, EPHA7, EPHB2, KIF5A, KIF5B and KIF5C.

Forms a ternary complex with GRIA2 and CSPG4.

Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly.

Interacts with SLC30A9 and PLCD4.

Interacts with BUD23 (By similarity).

Forms a complex with NSG1, GRIA2 and STX12; controls the intracellular fate of AMPAR and the endosomal sorting of the GRIA2 subunit toward recycling and membrane targeting.

Interacts with NSG1 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
216454, 10 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q925T6

Protein interaction database and analysis system

More...
IntActi
Q925T6, 14 interactors

Molecular INTeraction database

More...
MINTi
Q925T6

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000123234

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11127
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q925T6

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q925T6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini53 – 136PDZ 1PROSITE-ProRule annotationAdd BLAST84
Domaini150 – 238PDZ 2PROSITE-ProRule annotationAdd BLAST89
Domaini252 – 336PDZ 3PROSITE-ProRule annotationAdd BLAST85
Domaini471 – 560PDZ 4PROSITE-ProRule annotationAdd BLAST90
Domaini572 – 657PDZ 5PROSITE-ProRule annotationAdd BLAST86
Domaini672 – 754PDZ 6PROSITE-ProRule annotationAdd BLAST83
Domaini1003 – 1085PDZ 7PROSITE-ProRule annotationAdd BLAST83

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 6 mediates interaction with the C-terminal of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1. PDZ 4 and PDZ 5 mediate interaction with PRLHR (By similarity). PDZ 7 domain binds CSPG4.By similarity1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3528 Eukaryota
ENOG410XSUX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158692

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000043120

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q925T6

KEGG Orthology (KO)

More...
KOi
K20251

Database of Orthologous Groups

More...
OrthoDBi
1313182at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q925T6

TreeFam database of animal gene trees

More...
TreeFami
TF326909

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030026 GRIP1
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf

The PANTHER Classification System

More...
PANTHERi
PTHR46227:SF3 PTHR46227:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 6 hits
PF17820 PDZ_6, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 7 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 7 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q925T6-1) [UniParc]FASTAAdd to basket
Also known as: GRIP1a-L

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIAVSFKCRC QILRRLTKDE SPYTKSASQT KPPDGALAVR RQSIPEEFKG
60 70 80 90 100
STVVELMKKE GTTLGLTVSG GIDKDGKPRV SNLRQGGIAA RSDQLDVGDY
110 120 130 140 150
IKAVNGINLA KFRHDEIISL LKNVGERVVL EVEYELPPVS VQGSSVMFRT
160 170 180 190 200
VEVTLHKEGN TFGFVIRGGA HDDRNKSRPV VITCVRPGGP ADREGTIKPG
210 220 230 240 250
DRLLSVDGIR LLGTTHAEAM SILKQCGQEA TLLIEYDVSV MDSVATASGP
260 270 280 290 300
LLVEVAKTPG ASLGVALTTS VCCNKQVIVI DKIKSASIAD RCGALHVGDH
310 320 330 340 350
ILSIDGTSME YCTLAEATQF LANTTDQVKL EILPHHQTRL ALKGPDHVKI
360 370 380 390 400
QRSDRQHPWD AWASNQCGVH TNHHHNTYHP DHCRVPALTF PKALPPNSPP
410 420 430 440 450
AMVPSSSPTS MSAYSLSSLN MGTLPRSLYS TSPRGTMMRR RLKKKDFKSS
460 470 480 490 500
LSLASSTVGL AGQVVHTETT EVVLTADPVT GFGIQLQGSV FATETLSSPP
510 520 530 540 550
LISYIEADSP AERCGVLQIG DRVMAINGIP TEDSTFEEAN QLLRDSSITS
560 570 580 590 600
KVTLEIEFDV AESVIPSSGT FHVKLPKKHS VELGITISSP SSRKPGDPLV
610 620 630 640 650
ISDIKKGSVA HRTGTLELGD KLLAIDNIRL DNCSMEDAVQ ILQQCEDLVK
660 670 680 690 700
LKIRKDEDNS DEQESSGAII YTVELKRYGG PLGITISGTE EPFDPIIISS
710 720 730 740 750
LTKGGLAERT GAIHIGDRIL AINSSSLKGK PLSEAIHLLQ MAGETVTLKI
760 770 780 790 800
KKQTDAQSAS SPKKFPIPGH SGDLGDGEED PSPIQKPGKL SDAYPSTVPS
810 820 830 840 850
VDSAVDSWDG SGIDASYGSQ GSTFQTSGYN YNTYDWRSPK QRTSLSPVPK
860 870 880 890 900
PRSQTYPDVG LSNEDWDRST ASGFVGASDS ADAEQEENFW SQALEDLETC
910 920 930 940 950
GQSGILRELE EKADRRVSLR NMTLLATIMS GSTMSLNHEA PMARSQLGRQ
960 970 980 990 1000
ASFQERSSSR PHYSQTTRSN TLPSDVGRKS VTLRKMKQEI KEIMSPTPVE
1010 1020 1030 1040 1050
LHKVTLYKDS GMEDFGFSVA DGLLEKGVYV KNIRPAGPGD VGGLKPYDRL
1060 1070 1080 1090 1100
LQVNHVRTRD FDCCLVVPLI AESGNKLDLV ISRNPLASQK SIEQPALPSD
1110 1120
WSEQNSAFFQ QPSHGGNLET REPTNTL
Length:1,127
Mass (Da):122,058
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i556DFCCE2CE6248A
GO
Isoform 2 (identifier: Q925T6-2) [UniParc]FASTAAdd to basket
Also known as: GRIP1b, GRIP1b-S

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIP → MPGWKKNIPICLQAEEQER
     348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A
     911-925: Missing.

Note: Major isoform.
Show »
Length:1,034
Mass (Da):111,487
Checksum:i91DF2CDD7367028A
GO
Isoform 3 (identifier: Q925T6-3) [UniParc]FASTAAdd to basket
Also known as: GRIP1a-S

The sequence of this isoform differs from the canonical sequence as follows:
     19-45: Missing.
     348-400: VKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSPP → A
     911-925: Missing.

Note: May be due to exons 2, 10 and 11 skipping. No experimental confirmation available.
Show »
Length:1,033
Mass (Da):111,383
Checksum:i82F04408111C9AF2
GO
Isoform 4 (identifier: Q925T6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-415: Missing.
     416-451: LSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSL → MTAKRAERKEMKRPNSFHLPFRPSLRKGQKKNAAHV
     756-820: Missing.
     911-925: Missing.

Note: No experimental confirmation available.
Show »
Length:632
Mass (Da):68,966
Checksum:i172ACDBA40467E43
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BX09H7BX09_MOUSE
Glutamate receptor-interacting prot...
Grip1
1,061Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BX90H7BX90_MOUSE
Glutamate receptor-interacting prot...
Grip1
1,060Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6GQT7Q6GQT7_MOUSE
Glutamate receptor-interacting prot...
Grip1
1,113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YWY4D3YWY4_MOUSE
Glutamate receptor-interacting prot...
Grip1
1,075Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z066D3Z066_MOUSE
Glutamate receptor-interacting prot...
Grip1
697Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YZL8D3YZL8_MOUSE
Glutamate receptor-interacting prot...
Grip1
1,112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z6T4D3Z6T4_MOUSE
Glutamate receptor-interacting prot...
Grip1
1,112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z6R6D3Z6R6_MOUSE
Glutamate receptor-interacting prot...
Grip1
712Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6X4T6Q6X4T6_MOUSE
Glutamate receptor-interacting prot...
Grip1
631Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1011G → C in BAC26668 (PubMed:16141072).Curated1
Sequence conflicti1044L → M in BAC31662 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0097451 – 415Missing in isoform 4. 1 PublicationAdd BLAST415
Alternative sequenceiVSP_0097441 – 45MIAVS…RQSIP → MPGWKKNIPICLQAEEQER in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_00974619 – 45Missing in isoform 3. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_009747348 – 400VKIQR…PNSPP → A in isoform 2 and isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_009748416 – 451LSSLN…FKSSL → MTAKRAERKEMKRPNSFHLP FRPSLRKGQKKNAAHV in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_009749756 – 820Missing in isoform 4. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_009750911 – 925Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB051560 mRNA Translation: BAB46929.1
AB051561 mRNA Translation: BAB46930.1
AB051562 mRNA Translation: BAB46931.1
AK029905 mRNA Translation: BAC26668.1
AK043821 mRNA Translation: BAC31662.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS24202.1 [Q925T6-1]
CCDS36071.1 [Q925T6-2]
CCDS36072.1 [Q925T6-3]
CCDS70114.1 [Q925T6-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001264221.1, NM_001277292.1
NP_001264223.1, NM_001277294.1
NP_001264224.1, NM_001277295.1 [Q925T6-4]
NP_083012.1, NM_028736.2 [Q925T6-1]
NP_570961.1, NM_130891.2 [Q925T6-3]
NP_597699.1, NM_133442.2 [Q925T6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000077871; ENSMUSP00000077033; ENSMUSG00000034813 [Q925T6-2]
ENSMUST00000105261; ENSMUSP00000100896; ENSMUSG00000034813 [Q925T6-4]
ENSMUST00000138410; ENSMUSP00000123234; ENSMUSG00000034813 [Q925T6-1]
ENSMUST00000144825; ENSMUSP00000121670; ENSMUSG00000034813 [Q925T6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
74053

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:74053

UCSC genome browser

More...
UCSCi
uc007heg.2 mouse [Q925T6-2]
uc007hek.2 mouse [Q925T6-1]
uc007hel.2 mouse [Q925T6-3]
uc007hep.2 mouse [Q925T6-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051560 mRNA Translation: BAB46929.1
AB051561 mRNA Translation: BAB46930.1
AB051562 mRNA Translation: BAB46931.1
AK029905 mRNA Translation: BAC26668.1
AK043821 mRNA Translation: BAC31662.2
CCDSiCCDS24202.1 [Q925T6-1]
CCDS36071.1 [Q925T6-2]
CCDS36072.1 [Q925T6-3]
CCDS70114.1 [Q925T6-4]
RefSeqiNP_001264221.1, NM_001277292.1
NP_001264223.1, NM_001277294.1
NP_001264224.1, NM_001277295.1 [Q925T6-4]
NP_083012.1, NM_028736.2 [Q925T6-1]
NP_570961.1, NM_130891.2 [Q925T6-3]
NP_597699.1, NM_133442.2 [Q925T6-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V5QNMR-A461-569[»]
SMRiQ925T6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi216454, 10 interactors
CORUMiQ925T6
IntActiQ925T6, 14 interactors
MINTiQ925T6
STRINGi10090.ENSMUSP00000123234

PTM databases

iPTMnetiQ925T6
PhosphoSitePlusiQ925T6
SwissPalmiQ925T6

Proteomic databases

PaxDbiQ925T6
PRIDEiQ925T6

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000077871; ENSMUSP00000077033; ENSMUSG00000034813 [Q925T6-2]
ENSMUST00000105261; ENSMUSP00000100896; ENSMUSG00000034813 [Q925T6-4]
ENSMUST00000138410; ENSMUSP00000123234; ENSMUSG00000034813 [Q925T6-1]
ENSMUST00000144825; ENSMUSP00000121670; ENSMUSG00000034813 [Q925T6-3]
GeneIDi74053
KEGGimmu:74053
UCSCiuc007heg.2 mouse [Q925T6-2]
uc007hek.2 mouse [Q925T6-1]
uc007hel.2 mouse [Q925T6-3]
uc007hep.2 mouse [Q925T6-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23426
MGIiMGI:1921303 Grip1

Phylogenomic databases

eggNOGiKOG3528 Eukaryota
ENOG410XSUX LUCA
GeneTreeiENSGT00940000158692
HOGENOMiHOG000043120
InParanoidiQ925T6
KOiK20251
OrthoDBi1313182at2759
PhylomeDBiQ925T6
TreeFamiTF326909

Enzyme and pathway databases

ReactomeiR-MMU-416993 Trafficking of GluR2-containing AMPA receptors

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Grip1 mouse
EvolutionaryTraceiQ925T6

Protein Ontology

More...
PROi
PR:Q925T6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000034813 Expressed in 212 organ(s), highest expression level in rostral migratory stream
ExpressionAtlasiQ925T6 baseline and differential
GenevisibleiQ925T6 MM

Family and domain databases

InterProiView protein in InterPro
IPR030026 GRIP1
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf
PANTHERiPTHR46227:SF3 PTHR46227:SF3, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 6 hits
PF17820 PDZ_6, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 7 hits
SUPFAMiSSF50156 SSF50156, 7 hits
PROSITEiView protein in PROSITE
PS50106 PDZ, 7 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGRIP1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q925T6
Secondary accession number(s): Q8BLQ3
, Q8C0T3, Q925T5, Q925T7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: December 1, 2001
Last modified: September 18, 2019
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again