Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (18 Sep 2019)
Sequence version 2 (30 Aug 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Kinesin-associated protein 3

Gene

KIFAP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Binds to the tail domain of the KIF3A/KIF3B heterodimer to form a heterotrimeric KIF3 complex and may regulate the membrane binding of this complex (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1445148 Translocation of SLC2A4 (GLUT4) to the plasma membrane
R-HSA-2132295 MHC class II antigen presentation
R-HSA-5620924 Intraflagellar transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q92845

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-associated protein 3
Short name:
KAP-3
Short name:
KAP3
Alternative name(s):
Smg GDS-associated protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KIFAP3
Synonyms:KIF3AP, SMAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17060 KIFAP3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601836 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92845

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
22920

Open Targets

More...
OpenTargetsi
ENSG00000075945

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30111

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KIFAP3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
73920216

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000843021 – 792Kinesin-associated protein 3Add BLAST792

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei60PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine residues by SRC in vitro; this reduces the binding affinity of the protein for RAP1GDS1.1 Publication

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q92845

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q92845

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q92845

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q92845

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q92845

PeptideAtlas

More...
PeptideAtlasi
Q92845

PRoteomics IDEntifications database

More...
PRIDEi
Q92845

ProteomicsDB human proteome resource

More...
ProteomicsDBi
26809
3111
3112
75540 [Q92845-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q92845

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q92845

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000075945 Expressed in 222 organ(s), highest expression level in superior frontal gyrus

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92845 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023738
HPA023742

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotrimer of KIFAP3, KIF3A and KIF3B.

Interacts with RAP1GDS1/SMG GDS.

Interacts with SMC3 subunit of the cohesin complex.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116582, 83 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-3200 KIF3 complex variant AC-KAP3
CPX-3201 KIF3 complex variant AB-KAP3

Protein interaction database and analysis system

More...
IntActi
Q92845, 78 interactors

Molecular INTeraction database

More...
MINTi
Q92845

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000354560

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati333 – 373ARM 1Add BLAST41
Repeati374 – 412ARM 2Add BLAST39
Repeati494 – 533ARM 3Add BLAST40
Repeati578 – 620ARM 4Add BLAST43
Repeati621 – 662ARM 5Add BLAST42

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1222 Eukaryota
ENOG410XT8I LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003574

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000012952

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92845

Identification of Orthologs from Complete Genome Data

More...
OMAi
FMFKSNK

Database of Orthologous Groups

More...
OrthoDBi
535512at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92845

TreeFam database of animal gene trees

More...
TreeFami
TF314964

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo
IPR008658 KAP3

The PANTHER Classification System

More...
PANTHERi
PTHR15605 PTHR15605, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00185 ARM, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50176 ARM_REPEAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q92845-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQGEDARYLK RKVKGGNIDV HPSEKALIVH YEVEATILGE MGDPMLGERK
60 70 80 90 100
ECQKIIRLKS LNANTDITSL ARKVVEECKL IHPSKLNEVE QLLYYLQNRR
110 120 130 140 150
DSLSGKEKKE KSSKPKDPPP FEGMEIDEVA NINDMDEYIE LLYEDIPDKV
160 170 180 190 200
RGSALILQLA RNPDNLEELL LNETALGALA RVLREDWKQS VELATNIIYI
210 220 230 240 250
FFCFSSFSQF HGLITHYKIG ALCMNIIDHE LKRHELWQEE LSKKKKAVDE
260 270 280 290 300
DPENQTLRKD YEKTFKKYQG LVVKQEQLLR VALYLLLNLA EDTRTELKMR
310 320 330 340 350
NKNIVHMLVK ALDRDNFELL ILVVSFLKKL SIFMENKNDM VEMDIVEKLV
360 370 380 390 400
KMIPCEHEDL LNITLRLLLN LSFDTGLRNK MVQVGLLPKL TALLGNDNYK
410 420 430 440 450
QIAMCVLYHI SMDDRFKSMF AYTDCIPQLM KMLFECSDER IDLELISFCI
460 470 480 490 500
NLAANKRNVQ LICEGNGLKM LMKRALKFKD PLLMKMIRNI SQHDGPTKNL
510 520 530 540 550
FIDYVGDLAA QISNDEEEEF VIECLGTLAN LTIPDLDWEL VLKEYKLVPY
560 570 580 590 600
LKDKLKPGAA EDDLVLEVVI MIGTVSMDDS CAALLAKSGI IPALIELLNA
610 620 630 640 650
QQEDDEFVCQ IIYVFYQMVF HQATRDVIIK ETQAPAYLID LMHDKNNEIR
660 670 680 690 700
KVCDNTLDII AEYDEEWAKK IQSEKFRWHN SQWLEMVESR QMDESEQYLY
710 720 730 740 750
GDDRIEPYIH EGDILERPDL FYNSDGLIAS EGAISPDFFN DYHLQNGDVV
760 770 780 790
GQHSFPGSLG MDGFGQPVGI LGRPATAYGF RPDEPYYYGY GS
Length:792
Mass (Da):91,205
Last modified:August 30, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1887A75D811DF56A
GO
Isoform 2 (identifier: Q92845-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-55: RKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKI → S

Note: No experimental confirmation available.
Show »
Length:748
Mass (Da):86,290
Checksum:i7183BDA516248AC4
GO
Isoform 3 (identifier: Q92845-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: Missing.

Note: No experimental confirmation available.
Show »
Length:752
Mass (Da):86,728
Checksum:i65A2E06360616022
GO
Isoform 4 (identifier: Q92845-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-106: MQGEDARYLK...QNRRDSLSGK → MSIALGNTYRRSLSDSETVSVLQASLCE

Show »
Length:714
Mass (Da):82,144
Checksum:iCF12D8DEF30AF92B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti91Q → L in AAC50788 (PubMed:8900189).Curated1
Sequence conflicti734I → V in BAH13889 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051081513S → A. Corresponds to variant dbSNP:rs12075833Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0471321 – 106MQGED…SLSGK → MSIALGNTYRRSLSDSETVS VLQASLCE in isoform 4. 1 PublicationAdd BLAST106
Alternative sequenceiVSP_0471331 – 40Missing in isoform 3. CuratedAdd BLAST40
Alternative sequenceiVSP_04450511 – 55RKVKG…ECQKI → S in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U59919 mRNA Translation: AAC50788.1
AK297368 mRNA Translation: BAH12562.1
AK303052 mRNA Translation: BAH13889.1
AK315586 mRNA Translation: BAG37958.1
AL356475 Genomic DNA No translation available.
AL121714 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90872.1
CH471067 Genomic DNA Translation: EAW90873.1
CH471067 Genomic DNA Translation: EAW90871.1
BC028679 mRNA Translation: AAH28679.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1288.1 [Q92845-1]
CCDS55659.1 [Q92845-4]
CCDS55660.1 [Q92845-3]
CCDS55661.1 [Q92845-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001191443.1, NM_001204514.1 [Q92845-4]
NP_001191445.1, NM_001204516.1 [Q92845-2]
NP_001191446.1, NM_001204517.1 [Q92845-3]
NP_055785.2, NM_014970.3 [Q92845-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000361580; ENSP00000354560; ENSG00000075945 [Q92845-1]
ENST00000367765; ENSP00000356739; ENSG00000075945 [Q92845-3]
ENST00000367767; ENSP00000356741; ENSG00000075945 [Q92845-2]
ENST00000538366; ENSP00000444622; ENSG00000075945 [Q92845-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22920

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22920

UCSC genome browser

More...
UCSCi
uc001ggv.4 human [Q92845-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59919 mRNA Translation: AAC50788.1
AK297368 mRNA Translation: BAH12562.1
AK303052 mRNA Translation: BAH13889.1
AK315586 mRNA Translation: BAG37958.1
AL356475 Genomic DNA No translation available.
AL121714 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90872.1
CH471067 Genomic DNA Translation: EAW90873.1
CH471067 Genomic DNA Translation: EAW90871.1
BC028679 mRNA Translation: AAH28679.1
CCDSiCCDS1288.1 [Q92845-1]
CCDS55659.1 [Q92845-4]
CCDS55660.1 [Q92845-3]
CCDS55661.1 [Q92845-2]
RefSeqiNP_001191443.1, NM_001204514.1 [Q92845-4]
NP_001191445.1, NM_001204516.1 [Q92845-2]
NP_001191446.1, NM_001204517.1 [Q92845-3]
NP_055785.2, NM_014970.3 [Q92845-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi116582, 83 interactors
ComplexPortaliCPX-3200 KIF3 complex variant AC-KAP3
CPX-3201 KIF3 complex variant AB-KAP3
IntActiQ92845, 78 interactors
MINTiQ92845
STRINGi9606.ENSP00000354560

PTM databases

iPTMnetiQ92845
PhosphoSitePlusiQ92845

Polymorphism and mutation databases

BioMutaiKIFAP3
DMDMi73920216

Proteomic databases

EPDiQ92845
jPOSTiQ92845
MassIVEiQ92845
MaxQBiQ92845
PaxDbiQ92845
PeptideAtlasiQ92845
PRIDEiQ92845
ProteomicsDBi26809
3111
3112
75540 [Q92845-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
22920
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361580; ENSP00000354560; ENSG00000075945 [Q92845-1]
ENST00000367765; ENSP00000356739; ENSG00000075945 [Q92845-3]
ENST00000367767; ENSP00000356741; ENSG00000075945 [Q92845-2]
ENST00000538366; ENSP00000444622; ENSG00000075945 [Q92845-4]
GeneIDi22920
KEGGihsa:22920
UCSCiuc001ggv.4 human [Q92845-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22920
DisGeNETi22920

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KIFAP3
HGNCiHGNC:17060 KIFAP3
HPAiHPA023738
HPA023742
MIMi601836 gene
neXtProtiNX_Q92845
OpenTargetsiENSG00000075945
PharmGKBiPA30111

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1222 Eukaryota
ENOG410XT8I LUCA
GeneTreeiENSGT00390000003574
HOGENOMiHOG000012952
InParanoidiQ92845
OMAiFMFKSNK
OrthoDBi535512at2759
PhylomeDBiQ92845
TreeFamiTF314964

Enzyme and pathway databases

ReactomeiR-HSA-1445148 Translocation of SLC2A4 (GLUT4) to the plasma membrane
R-HSA-2132295 MHC class II antigen presentation
R-HSA-5620924 Intraflagellar transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins
SignaLinkiQ92845

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KIFAP3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KIFAP3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22920

Pharos

More...
Pharosi
Q92845

Protein Ontology

More...
PROi
PR:Q92845

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000075945 Expressed in 222 organ(s), highest expression level in superior frontal gyrus
GenevisibleiQ92845 HS

Family and domain databases

Gene3Di1.25.10.10, 2 hits
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo
IPR008658 KAP3
PANTHERiPTHR15605 PTHR15605, 1 hit
SMARTiView protein in SMART
SM00185 ARM, 3 hits
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50176 ARM_REPEAT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKIFA3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92845
Secondary accession number(s): B1AKU4
, B1AKU5, B2RDL1, B7Z8A3, F5H591, Q8NHU7, Q9H416
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: August 30, 2005
Last modified: September 18, 2019
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again