Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (18 Sep 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transmembrane protein 230

Gene

TMEM230

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in trafficking and recycling of synaptic vesicles.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.B.232.1.1 the parkinson's disease tmem230 (tmem230) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein 230
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMEM230
Synonyms:C20orf30
ORF Names:HSPC274, UNQ2432/PRO4992
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15876 TMEM230

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617019 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96A57

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei46 – 66HelicalSequence analysisAdd BLAST21
Transmembranei79 – 99HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Endosome, Golgi apparatus, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Parkinson disease (PARK)1 Publication
The gene represented in this entry may be involved in disease pathogenesis. Genetic variants in TMEM230 and DNAJC13 have been found in the same large multigenerational family with adult-onset Parkinson disease. The pathological role of each gene and therefore the exact molecular basis of the disease is unclear.1 Publication
Disease descriptionA complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability. Additional features are characteristic postural abnormalities, dysautonomia, dystonic cramps, and dementia. The pathology of Parkinson disease involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. The disease is progressive and usually manifests after the age of 50 years, although early-onset cases (before 50 years) are known. The majority of the cases are sporadic suggesting a multifactorial etiology based on environmental and genetic factors. However, some patients present with a positive family history for the disease. Familial forms of the disease usually begin at earlier ages and are associated with atypical clinical features.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07671329Y → C in PARK; sporadic case; unknown pathological significance; results in decreased synaptic vesicle trafficking. 1 PublicationCorresponds to variant dbSNP:rs1056737920Ensembl.1
Natural variantiVAR_07671478R → L in PARK; unknown pathological significance; results in decreased synaptic vesicle trafficking. 1 PublicationCorresponds to variant dbSNP:rs764786986Ensembl.1

Keywords - Diseasei

Disease mutation, Neurodegeneration, Parkinson disease, Parkinsonism

Organism-specific databases

DisGeNET

More...
DisGeNETi
29058
MIMi168600 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000089063

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25746

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMEM230

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74751737

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002338921 – 120Transmembrane protein 230Add BLAST120

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei15PhosphoserineCombined sources1
Modified residuei23PhosphoserineCombined sources1
Modified residuei24PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-960

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96A57

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96A57

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96A57

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96A57

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96A57

PeptideAtlas

More...
PeptideAtlasi
Q96A57

PRoteomics IDEntifications database

More...
PRIDEi
Q96A57

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75916 [Q96A57-1]
75917 [Q96A57-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q96A57-1 [Q96A57-1]
Q96A57-2 [Q96A57-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96A57

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96A57

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000089063 Expressed in 100 organ(s), highest expression level in C1 segment of cervical spinal cord

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96A57 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96A57 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA009078
HPA061421

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118834, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q96A57, 14 interactors

Molecular INTeraction database

More...
MINTi
Q96A57

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000341364

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TMEM134/TMEM230 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4753 Eukaryota
ENOG4111TWA LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008694

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96A57

Identification of Orthologs from Complete Genome Data

More...
OMAi
FDKIPWK

Database of Orthologous Groups

More...
OrthoDBi
1357985at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96A57

TreeFam database of animal gene trees

More...
TreeFami
TF329240

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008590 DUF872_TM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05915 DUF872, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q96A57-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMPSRTNLAT GIPSSKVKYS RLSSTDDGYI DLQFKKTPPK IPYKAIALAT
60 70 80 90 100
VLFLIGAFLI IIGSLLLSGY ISKGGADRAV PVLIIGILVF LPGFYHLRIA
110 120
YYASKGYRGY SYDDIPDFDD
Length:120
Mass (Da):13,188
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i18A4A556330D77CE
GO
Isoform 1 (identifier: Q96A57-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQPWALPTVGELWVCGRPGAALRWSLVLSPRLEPSGVISAHCNLHLLASSDSSASASRLCQRVM

Show »
Length:183
Mass (Da):19,910
Checksum:iDBE684AF9FEFBDEB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WTT2A0A087WTT2_HUMAN
Transmembrane protein 230
TMEM230
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JWB9Q5JWB9_HUMAN
Transmembrane protein 230
TMEM230
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Isoform 1 : The sequence AAF28952 differs from that shown. Reason: Frameshift at several positions.Curated1 Publication

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti59 – 61LII → SY in AAF28952 (Ref. 1) Curated3
Sequence conflicti109G → A in AAH11990 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07671329Y → C in PARK; sporadic case; unknown pathological significance; results in decreased synaptic vesicle trafficking. 1 PublicationCorresponds to variant dbSNP:rs1056737920Ensembl.1
Natural variantiVAR_07671478R → L in PARK; unknown pathological significance; results in decreased synaptic vesicle trafficking. 1 PublicationCorresponds to variant dbSNP:rs764786986Ensembl.1
Natural variantiVAR_076715108R → C1 PublicationCorresponds to variant dbSNP:rs143571424Ensembl.1
Isoform 1 (identifier: Q96A57-2)
Natural varianti64M → TCurated1 PublicationCorresponds to variant dbSNP:rs141394228Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0181551M → MQPWALPTVGELWVCGRPGA ALRWSLVLSPRLEPSGVISA HCNLHLLASSDSSASASRLC QRVM in isoform 1. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF161392 mRNA Translation: AAF28952.1 Frameshift.
AY359115 mRNA Translation: AAQ89473.1
AK315606 mRNA Translation: BAG37975.1
AL121890 Genomic DNA No translation available.
AL121924 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10431.1
CH471133 Genomic DNA Translation: EAX10432.1
CH471133 Genomic DNA Translation: EAX10433.1
CH471133 Genomic DNA Translation: EAX10434.1
CH471133 Genomic DNA Translation: EAX10437.1
BC070212 mRNA Translation: AAH70212.1
BC009768 mRNA Translation: AAH09768.1
BC009769 mRNA Translation: AAH09769.1
BC009770 mRNA Translation: AAH09770.1
BC011990 mRNA Translation: AAH11990.1
BC015113 mRNA Translation: AAH15113.1
BC110408 mRNA Translation: AAI10409.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13086.1 [Q96A57-1]
CCDS33438.1 [Q96A57-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001009923.1, NM_001009923.1 [Q96A57-2]
NP_001009924.1, NM_001009924.1 [Q96A57-1]
NP_001009925.1, NM_001009925.1 [Q96A57-1]
NP_001317913.1, NM_001330984.1 [Q96A57-1]
NP_001317914.1, NM_001330985.1 [Q96A57-1]
NP_001317915.1, NM_001330986.1 [Q96A57-1]
NP_054864.3, NM_014145.4 [Q96A57-1]
XP_016883325.1, XM_017027836.1 [Q96A57-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000202834; ENSP00000202834; ENSG00000089063 [Q96A57-1]
ENST00000342308; ENSP00000341364; ENSG00000089063 [Q96A57-2]
ENST00000379277; ENSP00000368579; ENSG00000089063 [Q96A57-1]
ENST00000379279; ENSP00000368581; ENSG00000089063 [Q96A57-1]
ENST00000379283; ENSP00000368585; ENSG00000089063 [Q96A57-1]
ENST00000379286; ENSP00000368588; ENSG00000089063 [Q96A57-1]
ENST00000379299; ENSP00000368601; ENSG00000089063 [Q96A57-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29058

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29058

UCSC genome browser

More...
UCSCi
uc002wlk.4 human [Q96A57-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF161392 mRNA Translation: AAF28952.1 Frameshift.
AY359115 mRNA Translation: AAQ89473.1
AK315606 mRNA Translation: BAG37975.1
AL121890 Genomic DNA No translation available.
AL121924 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10431.1
CH471133 Genomic DNA Translation: EAX10432.1
CH471133 Genomic DNA Translation: EAX10433.1
CH471133 Genomic DNA Translation: EAX10434.1
CH471133 Genomic DNA Translation: EAX10437.1
BC070212 mRNA Translation: AAH70212.1
BC009768 mRNA Translation: AAH09768.1
BC009769 mRNA Translation: AAH09769.1
BC009770 mRNA Translation: AAH09770.1
BC011990 mRNA Translation: AAH11990.1
BC015113 mRNA Translation: AAH15113.1
BC110408 mRNA Translation: AAI10409.2
CCDSiCCDS13086.1 [Q96A57-1]
CCDS33438.1 [Q96A57-2]
RefSeqiNP_001009923.1, NM_001009923.1 [Q96A57-2]
NP_001009924.1, NM_001009924.1 [Q96A57-1]
NP_001009925.1, NM_001009925.1 [Q96A57-1]
NP_001317913.1, NM_001330984.1 [Q96A57-1]
NP_001317914.1, NM_001330985.1 [Q96A57-1]
NP_001317915.1, NM_001330986.1 [Q96A57-1]
NP_054864.3, NM_014145.4 [Q96A57-1]
XP_016883325.1, XM_017027836.1 [Q96A57-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi118834, 11 interactors
IntActiQ96A57, 14 interactors
MINTiQ96A57
STRINGi9606.ENSP00000341364

Protein family/group databases

TCDBi9.B.232.1.1 the parkinson's disease tmem230 (tmem230) family

PTM databases

iPTMnetiQ96A57
PhosphoSitePlusiQ96A57

Polymorphism and mutation databases

BioMutaiTMEM230
DMDMi74751737

Proteomic databases

CPTACiCPTAC-960
EPDiQ96A57
jPOSTiQ96A57
MassIVEiQ96A57
MaxQBiQ96A57
PaxDbiQ96A57
PeptideAtlasiQ96A57
PRIDEiQ96A57
ProteomicsDBi75916 [Q96A57-1]
75917 [Q96A57-2]
TopDownProteomicsiQ96A57-1 [Q96A57-1]
Q96A57-2 [Q96A57-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
29058
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000202834; ENSP00000202834; ENSG00000089063 [Q96A57-1]
ENST00000342308; ENSP00000341364; ENSG00000089063 [Q96A57-2]
ENST00000379277; ENSP00000368579; ENSG00000089063 [Q96A57-1]
ENST00000379279; ENSP00000368581; ENSG00000089063 [Q96A57-1]
ENST00000379283; ENSP00000368585; ENSG00000089063 [Q96A57-1]
ENST00000379286; ENSP00000368588; ENSG00000089063 [Q96A57-1]
ENST00000379299; ENSP00000368601; ENSG00000089063 [Q96A57-1]
GeneIDi29058
KEGGihsa:29058
UCSCiuc002wlk.4 human [Q96A57-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29058
DisGeNETi29058

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMEM230
HGNCiHGNC:15876 TMEM230
HPAiHPA009078
HPA061421
MIMi168600 phenotype
617019 gene
neXtProtiNX_Q96A57
OpenTargetsiENSG00000089063
PharmGKBiPA25746

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4753 Eukaryota
ENOG4111TWA LUCA
GeneTreeiENSGT00390000008694
InParanoidiQ96A57
OMAiFDKIPWK
OrthoDBi1357985at2759
PhylomeDBiQ96A57
TreeFamiTF329240

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TMEM230 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29058

Pharos

More...
Pharosi
Q96A57

Protein Ontology

More...
PROi
PR:Q96A57

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000089063 Expressed in 100 organ(s), highest expression level in C1 segment of cervical spinal cord
ExpressionAtlasiQ96A57 baseline and differential
GenevisibleiQ96A57 HS

Family and domain databases

InterProiView protein in InterPro
IPR008590 DUF872_TM
PfamiView protein in Pfam
PF05915 DUF872, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTM230_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96A57
Secondary accession number(s): B2RDM8
, D3DVZ9, Q0VGC8, Q5TDS5, Q96ES2, Q9P0A7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: December 1, 2001
Last modified: September 18, 2019
This is version 138 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again