Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (08 May 2019)
Sequence version 2 (23 Nov 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

AMSH-like protease

Gene

STAMBPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains.1 Publication

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+1 PublicationNote: Binds 2 Zn2+ ions per subunit.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei292Indirect zinc-binding1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi347Zinc 1; catalyticPROSITE-ProRule annotation1
Metal bindingi349Zinc 1; catalyticPROSITE-ProRule annotation1
Metal bindingi360Zinc 1; catalyticPROSITE-ProRule annotation1
Metal bindingi362Zinc 21
Metal bindingi402Zinc 21
Metal bindingi408Zinc 21
Metal bindingi410Zinc 21

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5689901 Metalloprotease DUBs

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M67.003

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
AMSH-like protease (EC:3.4.19.-)
Short name:
AMSH-LP
Alternative name(s):
STAM-binding protein-like 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STAMBPL1
Synonyms:AMSHLP, KIAA1373
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24105 STAMBPL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612352 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96FJ0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi292E → A: Complete loss of catalytic activity. 1 Publication1
Mutagenesisi329E → A: 3-fold decrease in substrate affinity. 1 Publication1
Mutagenesisi332F → A: 12-fold decrease in substrate affinity, little effect on catalytic activity. 1 Publication1
Mutagenesisi353T → A: 19-fold decrease in activity, no change in substrate affinity. 1 Publication1
Mutagenesisi355F → A: 161-fold decrease in activity, no change in substrate affinity. 1 Publication1
Mutagenesisi357S → A: 34-fold decrease in activity. 1 Publication1
Mutagenesisi358S → A: 10-fold decrease in activity, no change in substrate affinity. 1 Publication1
Mutagenesisi360D → A: Complete loss of catalytic activity. 1 Publication1
Mutagenesisi370M → A: 18-fold decrease in substrate affinity, little effect on catalytic activity. 1 Publication1
Mutagenesisi402C → S: 402-fold decrease in activity, slight increase in substrate affinity. 1 Publication1
Mutagenesisi407F → A: 35-fold decrease in activity, slight increase in substrate affinity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
57559

Open Targets

More...
OpenTargetsi
ENSG00000138134

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670864

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
STAMBPL1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
71153542

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001948741 – 436AMSH-like proteaseAdd BLAST436

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei242PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96FJ0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96FJ0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96FJ0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96FJ0

PeptideAtlas

More...
PeptideAtlasi
Q96FJ0

PRoteomics IDEntifications database

More...
PRIDEi
Q96FJ0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76533
76534 [Q96FJ0-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96FJ0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96FJ0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138134 Expressed in 199 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96FJ0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96FJ0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA040202

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121614, 50 interactors

Protein interaction database and analysis system

More...
IntActi
Q96FJ0, 39 interactors

Molecular INTeraction database

More...
MINTi
Q96FJ0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000360994

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1436
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96FJ0

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q96FJ0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini269 – 397MPNPROSITE-ProRule annotationAdd BLAST129

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi347 – 360JAMM motifPROSITE-ProRule annotationAdd BLAST14

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The JAMM motif is essential for the protease activity.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M67C family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2880 Eukaryota
COG1310 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153710

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000195792

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96FJ0

KEGG Orthology (KO)

More...
KOi
K11867

Identification of Orthologs from Complete Genome Data

More...
OMAi
CHKFLLL

Database of Orthologous Groups

More...
OrthoDBi
411229at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96FJ0

TreeFam database of animal gene trees

More...
TreeFami
TF323215

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000555 JAMM/MPN+_dom
IPR037518 MPN
IPR015063 USP8_dimer

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01398 JAB, 1 hit
PF08969 USP8_dimer, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00232 JAB_MPN, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50249 MPN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96FJ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDQPFTVNSL KKLAAMPDHT DVSLSPEERV RALSKLGCNI TISEDITPRR
60 70 80 90 100
YFRSGVEMER MASVYLEEGN LENAFVLYNK FITLFVEKLP NHRDYQQCAV
110 120 130 140 150
PEKQDIMKKL KEIAFPRTDE LKNDLLKKYN VEYQEYLQSK NKYKAEILKK
160 170 180 190 200
LEHQRLIEAE RKRIAQMRQQ QLESEQFLFF EDQLKKQELA RGQMRSQQTS
210 220 230 240 250
GLSEQIDGSA LSCFSTHQNN SLLNVFADQP NKSDATNYAS HSPPVNRALT
260 270 280 290 300
PAATLSAVQN LVVEGLRCVV LPEDLCHKFL QLAESNTVRG IETCGILCGK
310 320 330 340 350
LTHNEFTITH VIVPKQSAGP DYCDMENVEE LFNVQDQHDL LTLGWIHTHP
360 370 380 390 400
TQTAFLSSVD LHTHCSYQLM LPEAIAIVCS PKHKDTGIFR LTNAGMLEVS
410 420 430
ACKKKGFHPH TKEPRLFSIC KHVLVKDIKI IVLDLR
Length:436
Mass (Da):49,783
Last modified:November 23, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i722662C76A734102
GO
Isoform 2 (identifier: Q96FJ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     420-436: CKHVLVKDIKIIVLDLR → QKFLSGIISGTALEMEPLKIGYGPNGFPLLGISRSSSPSEQL

Show »
Length:461
Mass (Da):52,199
Checksum:i266828EB12055970
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B3KR00B3KR00_HUMAN
AMSH-like protease
STAMBPL1
270Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA92611 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051817196S → N. Corresponds to variant dbSNP:rs12254856Ensembl.1
Natural variantiVAR_051818204E → K. Corresponds to variant dbSNP:rs34270879Ensembl.1
Natural variantiVAR_051819210A → T. Corresponds to variant dbSNP:rs9988723Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_014648420 – 436CKHVL…VLDLR → QKFLSGIISGTALEMEPLKI GYGPNGFPLLGISRSSSPSE QL in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB010120 mRNA Translation: BAC77766.1
AB037794 mRNA Translation: BAA92611.1 Different initiation.
AK056086 mRNA Translation: BAG51619.1
AL157394 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW50156.1
BC010846 mRNA Translation: AAH10846.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7391.1 [Q96FJ0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_065850.1, NM_020799.3 [Q96FJ0-1]
XP_006717991.1, XM_006717928.2 [Q96FJ0-1]
XP_006717993.1, XM_006717930.3 [Q96FJ0-1]
XP_011538285.1, XM_011539983.1 [Q96FJ0-1]
XP_011538287.1, XM_011539985.1 [Q96FJ0-1]
XP_016871942.1, XM_017016453.1 [Q96FJ0-1]
XP_016871943.1, XM_017016454.1
XP_016871944.1, XM_017016455.1 [Q96FJ0-1]
XP_016871945.1, XM_017016456.1 [Q96FJ0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000371924; ENSP00000360992; ENSG00000138134 [Q96FJ0-1]
ENST00000371926; ENSP00000360994; ENSG00000138134 [Q96FJ0-1]
ENST00000371927; ENSP00000360995; ENSG00000138134 [Q96FJ0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57559

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57559

UCSC genome browser

More...
UCSCi
uc001kfk.5 human [Q96FJ0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB010120 mRNA Translation: BAC77766.1
AB037794 mRNA Translation: BAA92611.1 Different initiation.
AK056086 mRNA Translation: BAG51619.1
AL157394 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW50156.1
BC010846 mRNA Translation: AAH10846.2
CCDSiCCDS7391.1 [Q96FJ0-1]
RefSeqiNP_065850.1, NM_020799.3 [Q96FJ0-1]
XP_006717991.1, XM_006717928.2 [Q96FJ0-1]
XP_006717993.1, XM_006717930.3 [Q96FJ0-1]
XP_011538285.1, XM_011539983.1 [Q96FJ0-1]
XP_011538287.1, XM_011539985.1 [Q96FJ0-1]
XP_016871942.1, XM_017016453.1 [Q96FJ0-1]
XP_016871943.1, XM_017016454.1
XP_016871944.1, XM_017016455.1 [Q96FJ0-1]
XP_016871945.1, XM_017016456.1 [Q96FJ0-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ZNRX-ray1.20A264-436[»]
2ZNVX-ray1.60A/D264-436[»]
SMRiQ96FJ0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi121614, 50 interactors
IntActiQ96FJ0, 39 interactors
MINTiQ96FJ0
STRINGi9606.ENSP00000360994

Protein family/group databases

MEROPSiM67.003

PTM databases

iPTMnetiQ96FJ0
PhosphoSitePlusiQ96FJ0

Polymorphism and mutation databases

BioMutaiSTAMBPL1
DMDMi71153542

Proteomic databases

EPDiQ96FJ0
jPOSTiQ96FJ0
MaxQBiQ96FJ0
PaxDbiQ96FJ0
PeptideAtlasiQ96FJ0
PRIDEiQ96FJ0
ProteomicsDBi76533
76534 [Q96FJ0-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371924; ENSP00000360992; ENSG00000138134 [Q96FJ0-1]
ENST00000371926; ENSP00000360994; ENSG00000138134 [Q96FJ0-1]
ENST00000371927; ENSP00000360995; ENSG00000138134 [Q96FJ0-2]
GeneIDi57559
KEGGihsa:57559
UCSCiuc001kfk.5 human [Q96FJ0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57559
DisGeNETi57559

GeneCards: human genes, protein and diseases

More...
GeneCardsi
STAMBPL1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0009014
HGNCiHGNC:24105 STAMBPL1
HPAiHPA040202
MIMi612352 gene
neXtProtiNX_Q96FJ0
OpenTargetsiENSG00000138134
PharmGKBiPA142670864

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2880 Eukaryota
COG1310 LUCA
GeneTreeiENSGT00940000153710
HOGENOMiHOG000195792
InParanoidiQ96FJ0
KOiK11867
OMAiCHKFLLL
OrthoDBi411229at2759
PhylomeDBiQ96FJ0
TreeFamiTF323215

Enzyme and pathway databases

ReactomeiR-HSA-5689901 Metalloprotease DUBs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
STAMBPL1 human
EvolutionaryTraceiQ96FJ0

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
STAMBPL1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57559

Protein Ontology

More...
PROi
PR:Q96FJ0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138134 Expressed in 199 organ(s), highest expression level in testis
ExpressionAtlasiQ96FJ0 baseline and differential
GenevisibleiQ96FJ0 HS

Family and domain databases

InterProiView protein in InterPro
IPR000555 JAMM/MPN+_dom
IPR037518 MPN
IPR015063 USP8_dimer
PfamiView protein in Pfam
PF01398 JAB, 1 hit
PF08969 USP8_dimer, 1 hit
SMARTiView protein in SMART
SM00232 JAB_MPN, 1 hit
PROSITEiView protein in PROSITE
PS50249 MPN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTALP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96FJ0
Secondary accession number(s): B3KPA7
, Q5T9N4, Q5T9N9, Q7Z420, Q9P2H4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: November 23, 2004
Last modified: May 8, 2019
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  7. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again