Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (18 Sep 2019)
Sequence version 3 (26 May 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Formin-like protein 2

Gene

FMNL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5663220 RHO GTPases Activate Formins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Formin-like protein 2
Alternative name(s):
Formin homology 2 domain-containing protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FMNL2
Synonyms:FHOD2, KIAA1902
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18267 FMNL2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616285 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96PY5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
114793

Open Targets

More...
OpenTargetsi
ENSG00000157827

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28144

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96PY5

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FMNL2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
238054383

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002890932 – 1086Formin-like protein 2Add BLAST1085

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei188PhosphoserineCombined sources1

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96PY5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96PY5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96PY5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96PY5

PeptideAtlas

More...
PeptideAtlasi
Q96PY5

PRoteomics IDEntifications database

More...
PRIDEi
Q96PY5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
77786 [Q96PY5-1]
77787 [Q96PY5-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96PY5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96PY5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157827 Expressed in 203 organ(s), highest expression level in subthalamic nucleus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96PY5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96PY5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA005464

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125355, 26 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q96PY5

Protein interaction database and analysis system

More...
IntActi
Q96PY5, 10 interactors

Molecular INTeraction database

More...
MINTi
Q96PY5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000288670

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11086
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96PY5

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini23 – 469GBD/FH3PROSITE-ProRule annotationAdd BLAST447
Domaini616 – 1007FH2PROSITE-ProRule annotationAdd BLAST392
Domaini1040 – 1079DADPROSITE-ProRule annotationAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi525 – 603Pro-richAdd BLAST79

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DAD domain regulates activation via by an autoinhibitory interaction with the GBD/FH3 domain. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the formin homology family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1923 Eukaryota
ENOG410Y3DT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155515

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231209

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96PY5

Identification of Orthologs from Complete Genome Data

More...
OMAi
MMPGFSP

Database of Orthologous Groups

More...
OrthoDBi
288325at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96PY5

TreeFam database of animal gene trees

More...
TreeFami
TF325155

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.58.2220, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR014767 DAD_dom
IPR015425 FH2_Formin
IPR042201 FH2_Formin_sf
IPR010472 FH3_dom
IPR027656 FMNL2
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd

The PANTHER Classification System

More...
PANTHERi
PTHR45857:SF5 PTHR45857:SF5, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51231 DAD, 1 hit
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96PY5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNAGSMDSQ QTDFRAHNVP LKLPMPEPGE LEERFAIVLN AMNLPPDKAR
60 70 80 90 100
LLRQYDNEKK WELICDQERF QVKNPPHTYI QKLKGYLDPA VTRKKFRRRV
110 120 130 140 150
QESTQVLREL EISLRTNHIG WVREFLNEEN KGLDVLVEYL SFAQYAVTFD
160 170 180 190 200
FESVESTVES SVDKSKPWSR SIEDLHRGSN LPSPVGNSVS RSGRHSALRY
210 220 230 240 250
NTLPSRRTLK NSRLVSKKDD VHVCIMCLRA IMNYQYGFNM VMSHPHAVNE
260 270 280 290 300
IALSLNNKNP RTKALVLELL AAVCLVRGGH EIILSAFDNF KEVCGEKQRF
310 320 330 340 350
EKLMEHFRNE DNNIDFMVAS MQFINIVVHS VEDMNFRVHL QYEFTKLGLD
360 370 380 390 400
EYLDKLKHTE SDKLQVQIQA YLDNVFDVGA LLEDAETKNA ALERVEELEE
410 420 430 440 450
NISHLSEKLQ DTENEAMSKI VELEKQLMQR NKELDVVREI YKDANTQVHT
460 470 480 490 500
LRKMVKEKEE AIQRQSTLEK KIHELEKQGT IKIQKKGDGD IAILPVVASG
510 520 530 540 550
TLSMGSEVVA GNSVGPTMGA ASSGPLPPPP PPLPPSSDTP ETVQNGPVTP
560 570 580 590 600
PMPPPPPPPP PPPPPPPPPP PPPLPGPAAE TVPAPPLAPP LPSAPPLPGT
610 620 630 640 650
SSPTVVFNSG LAAVKIKKPI KTKFRMPVFN WVALKPNQIN GTVFNEIDDE
660 670 680 690 700
RILEDLNVDE FEEIFKTKAQ GPAIDLSSSK QKIPQKGSNK VTLLEANRAK
710 720 730 740 750
NLAITLRKAG KTADEICKAI HVFDLKTLPV DFVECLMRFL PTENEVKVLR
760 770 780 790 800
LYERERKPLE NLSDEDRFMM QFSKIERLMQ KMTIMAFIGN FAESIQMLTP
810 820 830 840 850
QLHAIIAASV SIKSSQKLKK ILEIILALGN YMNSSKRGAV YGFKLQSLDL
860 870 880 890 900
LLDTKSTDRK QTLLHYISNV VKEKYHQVSL FYNELHYVEK AAAVSLENVL
910 920 930 940 950
LDVKELQRGM DLTKREYTMH DHNTLLKEFI LNNEGKLKKL QDDAKIAQDA
960 970 980 990 1000
FDDVVKYFGE NPKTTPPSVF FPVFVRFVKA YKQAEEENEL RKKQEQALME
1010 1020 1030 1040 1050
KLLEQEALME QQDPKSPSHK SKRQQQELIA ELRRRQVKDN RHVYEGKDGA
1060 1070 1080
IEDIITVLKT VPFTARTAKR GSRFFCEPVL TEEYHY
Note: No experimental confirmation available.
Length:1,086
Mass (Da):123,321
Last modified:May 26, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i951ED0A26232F640
GO
Isoform 2 (identifier: Q96PY5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1057-1086: VLKTVPFTARTAKRGSRFFCEPVLTEEYHY → DLRNQPYRRADAVRRSVRRRFDDQNLRSVNGAEITM

Show »
Length:1,092
Mass (Da):124,107
Checksum:iA20AA3D76733A717
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IZY8C9IZY8_HUMAN
Formin-like protein 2
FMNL2
461Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI13879 differs from that shown. Aberrant splicing.Curated
The sequence AAI14439 differs from that shown. Aberrant splicing.Curated
The sequence AAX88959 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAB67795 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti570P → PP in BAB67795 (PubMed:11572484).Curated1
Sequence conflicti570P → PP in AAI67159 (PubMed:15489334).Curated1
Sequence conflicti570P → PP in CAD39058 (PubMed:17974005).Curated1
Sequence conflicti579A → S in BAB67795 (PubMed:11572484).Curated1
Sequence conflicti579A → S in AAI67159 (PubMed:15489334).Curated1
Sequence conflicti964T → R in CAD39058 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032570352Y → C. Corresponds to variant dbSNP:rs34119671Ensembl.1
Natural variantiVAR_032571504M → T. Corresponds to variant dbSNP:rs11897929Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0258871057 – 1086VLKTV…EEYHY → DLRNQPYRRADAVRRSVRRR FDDQNLRSVNGAEITM in isoform 2. 3 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB067489 mRNA Translation: BAB67795.1 Different initiation.
AC012066 Genomic DNA No translation available.
AC012443 Genomic DNA Translation: AAX88959.1 Sequence problems.
AC093794 Genomic DNA No translation available.
BC113878 mRNA Translation: AAI13879.1 Sequence problems.
BC114438 mRNA Translation: AAI14439.1 Sequence problems.
BC167159 mRNA Translation: AAI67159.1
AL834396 mRNA Translation: CAD39058.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46429.1 [Q96PY5-3]

NCBI Reference Sequences

More...
RefSeqi
NP_443137.2, NM_052905.3 [Q96PY5-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000288670; ENSP00000288670; ENSG00000157827 [Q96PY5-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
114793

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:114793

UCSC genome browser

More...
UCSCi
uc002tye.3 human [Q96PY5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067489 mRNA Translation: BAB67795.1 Different initiation.
AC012066 Genomic DNA No translation available.
AC012443 Genomic DNA Translation: AAX88959.1 Sequence problems.
AC093794 Genomic DNA No translation available.
BC113878 mRNA Translation: AAI13879.1 Sequence problems.
BC114438 mRNA Translation: AAI14439.1 Sequence problems.
BC167159 mRNA Translation: AAI67159.1
AL834396 mRNA Translation: CAD39058.1
CCDSiCCDS46429.1 [Q96PY5-3]
RefSeqiNP_443137.2, NM_052905.3 [Q96PY5-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4YC7X-ray2.50B1-379[»]
SMRiQ96PY5
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi125355, 26 interactors
ELMiQ96PY5
IntActiQ96PY5, 10 interactors
MINTiQ96PY5
STRINGi9606.ENSP00000288670

PTM databases

iPTMnetiQ96PY5
PhosphoSitePlusiQ96PY5

Polymorphism and mutation databases

BioMutaiFMNL2
DMDMi238054383

Proteomic databases

jPOSTiQ96PY5
MassIVEiQ96PY5
MaxQBiQ96PY5
PaxDbiQ96PY5
PeptideAtlasiQ96PY5
PRIDEiQ96PY5
ProteomicsDBi77786 [Q96PY5-1]
77787 [Q96PY5-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
114793

Genome annotation databases

EnsembliENST00000288670; ENSP00000288670; ENSG00000157827 [Q96PY5-3]
GeneIDi114793
KEGGihsa:114793
UCSCiuc002tye.3 human [Q96PY5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
114793
DisGeNETi114793

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FMNL2
HGNCiHGNC:18267 FMNL2
HPAiHPA005464
MIMi616285 gene
neXtProtiNX_Q96PY5
OpenTargetsiENSG00000157827
PharmGKBiPA28144

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1923 Eukaryota
ENOG410Y3DT LUCA
GeneTreeiENSGT00940000155515
HOGENOMiHOG000231209
InParanoidiQ96PY5
OMAiMMPGFSP
OrthoDBi288325at2759
PhylomeDBiQ96PY5
TreeFamiTF325155

Enzyme and pathway databases

ReactomeiR-HSA-5663220 RHO GTPases Activate Formins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FMNL2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FMNL2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
114793
PharosiQ96PY5

Protein Ontology

More...
PROi
PR:Q96PY5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000157827 Expressed in 203 organ(s), highest expression level in subthalamic nucleus
ExpressionAtlasiQ96PY5 baseline and differential
GenevisibleiQ96PY5 HS

Family and domain databases

Gene3Di1.20.58.2220, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR014767 DAD_dom
IPR015425 FH2_Formin
IPR042201 FH2_Formin_sf
IPR010472 FH3_dom
IPR027656 FMNL2
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd
PANTHERiPTHR45857:SF5 PTHR45857:SF5, 1 hit
PfamiView protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit
SMARTiView protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51231 DAD, 1 hit
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFMNL2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96PY5
Secondary accession number(s): B2RZH5
, Q14CC9, Q4ZG52, Q8N3E0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 26, 2009
Last modified: September 18, 2019
This is version 143 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again