Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 187 (31 Jul 2019)
Sequence version 3 (30 May 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Krueppel-like factor 6

Gene

KLF6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional activator (By similarity). Binds a GC box motif. Could play a role in B-cell growth and development.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri200 – 224C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri230 – 254C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri260 – 282C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q99612

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q99612

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Krueppel-like factor 6
Alternative name(s):
B-cell-derived protein 1
Core promoter element-binding protein
GC-rich sites-binding factor GBF
Proto-oncogene BCD1
Suppressor of tumorigenicity 12 protein
Transcription factor Zf9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KLF6
Synonyms:BCD1, COPEB, CPBP, ST12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2235 KLF6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602053 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99612

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Gastric cancer (GASC)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.
Related information in OMIM
Prostate cancer (PC)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.
Related information in OMIM

Organism-specific databases

DisGeNET

More...
DisGeNETi
1316

MalaCards human disease database

More...
MalaCardsi
KLF6
MIMi176807 phenotype
613659 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000067082

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26751

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KLF6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
7387592

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000471711 – 283Krueppel-like factor 6Add BLAST283

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q99612

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99612

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q99612

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99612

PeptideAtlas

More...
PeptideAtlasi
Q99612

PRoteomics IDEntifications database

More...
PRIDEi
Q99612

ProteomicsDB human proteome resource

More...
ProteomicsDBi
26317
78355 [Q99612-1]
78356 [Q99612-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99612

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99612

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000067082 Expressed in 238 organ(s), highest expression level in thyroid gland

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99612 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB013529
HPA069585

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
RELAQ042066EBI-714994,EBI-73886

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107711, 20 interactors

Protein interaction database and analysis system

More...
IntActi
Q99612, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000419923

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99612

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri200 – 224C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri230 – 254C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri260 – 282C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158085

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231192

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99612

KEGG Orthology (KO)

More...
KOi
K09207

Identification of Orthologs from Complete Genome Data

More...
OMAi
PSHLWGC

Database of Orthologous Groups

More...
OrthoDBi
982312at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q99612

TreeFam database of animal gene trees

More...
TreeFami
TF350556

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q99612-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDVLPMCSIF QELQIVHETG YFSALPSLEE YWQQTCLELE RYLQSEPCYV
60 70 80 90 100
SASEIKFDSQ EDLWTKIILA REKKEESELK ISSSPPEDTL ISPSFCYNLE
110 120 130 140 150
TNSLNSDVSS ESSDSSEELS PTAKFTSDPI GEVLVSSGKL SSSVTSTPPS
160 170 180 190 200
SPELSREPSQ LWGCVPGELP SPGKVRSGTS GKPGDKGNGD ASPDGRRRVH
210 220 230 240 250
RCHFNGCRKV YTKSSHLKAH QRTHTGEKPY RCSWEGCEWR FARSDELTRH
260 270 280
FRKHTGAKPF KCSHCDRCFS RSDHLALHMK RHL
Length:283
Mass (Da):31,865
Last modified:May 30, 2000 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i84294A7E6D0A0231
GO
Isoform 2 (identifier: Q99612-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEG...HLALHMKRHL → QCPRGPRRAA...QSIRSFWSSE

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):30,615
Checksum:i99ECF169C9933D03
GO
Isoform 3 (identifier: Q99612-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL → VFPGLTTWPCT

Show »
Length:237
Mass (Da):26,110
Checksum:iC83EEA8CC9654022
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC23699 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA33050 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti276A → G in AAC39929 (PubMed:9689109).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06513664W → R Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 PublicationCorresponds to variant dbSNP:rs121909142EnsemblClinVar.1
Natural variantiVAR_065137116S → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 PublicationCorresponds to variant dbSNP:rs121909139EnsemblClinVar.1
Natural variantiVAR_065138123A → D Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 PublicationCorresponds to variant dbSNP:rs121909141EnsemblClinVar.1
Natural variantiVAR_065139155S → R Found in gastric cancer samples; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs121909144EnsemblClinVar.1
Natural variantiVAR_065140169L → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 PublicationCorresponds to variant dbSNP:rs121909143EnsemblClinVar.1
Natural variantiVAR_065141172P → T Found in gastric cancer samples; somatic mutation. 1 Publication1
Natural variantiVAR_065142180S → L Found in gastric cancer samples; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs372338890Ensembl.1
Natural variantiVAR_065143198R → K Found in gastric cancer samples; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_015715227 – 283EKPYR…MKRHL → QCPRGPRRAAAGGRHCIAPA LEGAGPGCTGCGQGRQILTS SDVFHQSIRSFWSSE in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_045808227 – 283EKPYR…MKRHL → VFPGLTTWPCT in isoform 3. CuratedAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U44975 mRNA Translation: AAC23699.1 Different initiation.
AF001461 mRNA Translation: AAC39929.1
AB017493 mRNA Translation: BAA33050.1 Different initiation.
AF284036 Genomic DNA Translation: AAM73548.1
BT006778 mRNA Translation: AAP35424.1
AL513303, AL450322 Genomic DNA Translation: CAH74049.1
AK293259 mRNA Translation: BAG56791.1
AK316596 mRNA Translation: BAG38183.1
AL513303, AL450322 Genomic DNA Translation: CAH74050.1
AL450322, AL513303 Genomic DNA Translation: CAH71010.1
AL450322, AL513303 Genomic DNA Translation: CAH71011.1
CH471072 Genomic DNA Translation: EAW86477.1
CH471072 Genomic DNA Translation: EAW86479.1
BC000311 mRNA Translation: AAH00311.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53490.1 [Q99612-3]
CCDS7060.1 [Q99612-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JE0235

NCBI Reference Sequences

More...
RefSeqi
NP_001153596.1, NM_001160124.1
NP_001153597.1, NM_001160125.1 [Q99612-3]
NP_001291.3, NM_001300.5 [Q99612-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000469435; ENSP00000419079; ENSG00000067082 [Q99612-2]
ENST00000497571; ENSP00000419923; ENSG00000067082 [Q99612-1]
ENST00000542957; ENSP00000445301; ENSG00000067082 [Q99612-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1316

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1316

UCSC genome browser

More...
UCSCi
uc001iha.4 human [Q99612-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44975 mRNA Translation: AAC23699.1 Different initiation.
AF001461 mRNA Translation: AAC39929.1
AB017493 mRNA Translation: BAA33050.1 Different initiation.
AF284036 Genomic DNA Translation: AAM73548.1
BT006778 mRNA Translation: AAP35424.1
AL513303, AL450322 Genomic DNA Translation: CAH74049.1
AK293259 mRNA Translation: BAG56791.1
AK316596 mRNA Translation: BAG38183.1
AL513303, AL450322 Genomic DNA Translation: CAH74050.1
AL450322, AL513303 Genomic DNA Translation: CAH71010.1
AL450322, AL513303 Genomic DNA Translation: CAH71011.1
CH471072 Genomic DNA Translation: EAW86477.1
CH471072 Genomic DNA Translation: EAW86479.1
BC000311 mRNA Translation: AAH00311.1
CCDSiCCDS53490.1 [Q99612-3]
CCDS7060.1 [Q99612-1]
PIRiJE0235
RefSeqiNP_001153596.1, NM_001160124.1
NP_001153597.1, NM_001160125.1 [Q99612-3]
NP_001291.3, NM_001300.5 [Q99612-1]

3D structure databases

SMRiQ99612
ModBaseiSearch...

Protein-protein interaction databases

BioGridi107711, 20 interactors
IntActiQ99612, 9 interactors
STRINGi9606.ENSP00000419923

PTM databases

iPTMnetiQ99612
PhosphoSitePlusiQ99612

Polymorphism and mutation databases

BioMutaiKLF6
DMDMi7387592

Proteomic databases

EPDiQ99612
jPOSTiQ99612
MaxQBiQ99612
PaxDbiQ99612
PeptideAtlasiQ99612
PRIDEiQ99612
ProteomicsDBi26317
78355 [Q99612-1]
78356 [Q99612-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1316
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000469435; ENSP00000419079; ENSG00000067082 [Q99612-2]
ENST00000497571; ENSP00000419923; ENSG00000067082 [Q99612-1]
ENST00000542957; ENSP00000445301; ENSG00000067082 [Q99612-3]
GeneIDi1316
KEGGihsa:1316
UCSCiuc001iha.4 human [Q99612-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1316
DisGeNETi1316

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KLF6
HGNCiHGNC:2235 KLF6
HPAiCAB013529
HPA069585
MalaCardsiKLF6
MIMi176807 phenotype
602053 gene
613659 phenotype
neXtProtiNX_Q99612
OpenTargetsiENSG00000067082
PharmGKBiPA26751

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000158085
HOGENOMiHOG000231192
InParanoidiQ99612
KOiK09207
OMAiPSHLWGC
OrthoDBi982312at2759
PhylomeDBiQ99612
TreeFamiTF350556

Enzyme and pathway databases

SignaLinkiQ99612
SIGNORiQ99612

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KLF6 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KLF6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1316

Protein Ontology

More...
PROi
PR:Q99612

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000067082 Expressed in 238 organ(s), highest expression level in thyroid gland
GenevisibleiQ99612 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKLF6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99612
Secondary accession number(s): B2RE86
, B4DDN0, D3DRR1, F5H3M5, Q5VUT7, Q5VUT8, Q9BT79
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: July 31, 2019
This is version 187 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again