Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (13 Feb 2019)
Sequence version 2 (26 Feb 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Cell cycle regulator of non-homologous end joining

Gene

CYREN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 1: Cell-cycle-specific inhibitor of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair during the S and G2 phases (PubMed:28959974). Acts as a regulator of DNA repair pathway choice by specifically inhibiting classical NHEJ during the S and G2 phases, thereby promoting error-free repair by homologous recombination during cell cycle phases when sister chromatids are present (PubMed:28959974). Preferentially protects single-stranded overhangs at break sites by inhibiting classical NHEJ, thereby creating a local environment that favors homologous recombination (PubMed:28959974). Acts via interaction with XRCC5/Ku80 and XRCC6/Ku70, interaction restricted during the S and G2 phases only (PubMed:28959974). Molecular mechanisms governing classical NHEJ inhibition via interaction with XRCC5/Ku80 and XRCC6/Ku70 are unknown (PubMed:28959974). May act as a regulator of proteasome (By similarity).By similarity1 Publication
Isoform 4: Cell-cycle-specific inhibitor of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair during the S and G2 phases (PubMed:24610814, PubMed:28959974). Acts as a regulator of DNA repair pathway choice by specifically inhibiting classical NHEJ during the S and G2 phases, thereby promoting error-free repair by homologous recombination during cell cycle phases when sister chromatids are present (PubMed:28959974). Preferentially protects single-stranded overhangs at break sites by inhibiting classical NHEJ, thereby creating a local environment that favors homologous recombination (PubMed:28959974). Acts via interaction with XRCC5/Ku80 and XRCC6/Ku70, interaction restricted during the S and G2 phases only (PubMed:28959974). Molecular mechanisms governing classical NHEJ inhibition via interaction with XRCC5/Ku80 and XRCC6/Ku70 are unknown (PubMed:28959974).2 Publications

Caution

Was initially reported to stimulate non-homologous end joining in vitro (PubMed:24610814). This result was not confirmed by another group (PubMed:28959974). The difference was possibly due to the consequences of oversaturating the reaction with recombinant protein in vitro (PubMed:28959974).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDNA damage, DNA repair

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cell cycle regulator of non-homologous end joining1 Publication
Short name:
Cell cycle regulator of NHEJ1 Publication
Alternative name(s):
Modulator of retrovirus infection homologBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CYRENImported
Synonyms:C7orf49Imported, MRIBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000122783.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:22432 CYREN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616980 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BWK5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi11R → A: Abolishes interaction with XRCC5/Ku80 and XRCC6/Ku70 and ability to inhibit classical non-homologous end joining (NHEJ). 1 Publication1
Mutagenesisi14P → A: Abolishes interaction with XRCC5/Ku80 and XRCC6/Ku70 and ability to inhibit classical non-homologous end joining (NHEJ). 1 Publication1
Mutagenesisi16W → A: Abolishes interaction with XRCC5/Ku80 and XRCC6/Ku70 and ability to inhibit classical non-homologous end joining (NHEJ). 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
78996

Open Targets

More...
OpenTargetsi
ENSG00000122783

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162380533

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C7orf49

Domain mapping of disease mutations (DMDM)

More...
DMDMi
182676205

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003209481 – 157Cell cycle regulator of non-homologous end joiningAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BWK5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BWK5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BWK5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BWK5

PeptideAtlas

More...
PeptideAtlasi
Q9BWK5

PRoteomics IDEntifications database

More...
PRIDEi
Q9BWK5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79284
79285 [Q9BWK5-2]
79286 [Q9BWK5-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BWK5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BWK5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000122783 Expressed in 209 organ(s), highest expression level in gastrocnemius

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BWK5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BWK5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA020060

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 1: Interacts (via KBM motif) with XRCC5/Ku80 and XRCC6/Ku70 heterodimer; interaction is restricted during the S and G2 phases (PubMed:24610814, PubMed:28959974). Isoform 4: Interacts (via KBM motif) with XRCC5/Ku80 and XRCC6/Ku70 heterodimer; interaction is restricted during the S and G2 phases (PubMed:24610814, PubMed:28959974). Isoform 3: Does not interact with XRCC5/Ku80 and XRCC6/Ku70 heterodimer (PubMed:24610814).2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ERCC6L2H7BXQ93EBI-8787584,EBI-10300946

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122467, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q9BWK5, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000376823

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BWK5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BWK5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1 – 21KBM1 PublicationAdd BLAST21

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The KBM (Ku-binding motif) mediates interaction with XRCC5/Ku80 and XRCC6/Ku70.1 Publication

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J164 Eukaryota
ENOG4111BHE LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013192

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113652

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108145

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BWK5

Identification of Orthologs from Complete Genome Data

More...
OMAi
RTVYCMN

Database of Orthologous Groups

More...
OrthoDBi
1634776at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BWK5

TreeFam database of animal gene trees

More...
TreeFami
TF336925

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028278 MRI

The PANTHER Classification System

More...
PANTHERi
PTHR14566 PTHR14566, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15325 MRI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BWK5-1) [UniParc]FASTAAdd to basket
Also known as: CYREN-11 Publication, MRI-11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METLQSETKT RVLPSWLTAQ VATKNVAPMK APKRMRMAAV PVAAARLPAT
60 70 80 90 100
RTVYCMNEAE IVDVALGILI ESRKQEKACE QPALAGADNP EHSPPCSVSP
110 120 130 140 150
HTSSGSSSEE EDSGKQALAP GLSPSQRPGG SSSACSRSPE EEEEEDVLKY

VREIFFS
Length:157
Mass (Da):16,829
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEA52CB3CCD231B74
GO
Isoform 2 (identifier: Q9BWK5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAA → MRLESLCHLCLACLFF

Note: No experimental confirmation available.
Show »
Length:128
Mass (Da):13,846
Checksum:i4F043DF622743C67
GO
Isoform 3 (identifier: Q9BWK5-3) [UniParc]FASTAAdd to basket
Also known as: CYREN-31 Publication, MRI-31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.

Show »
Length:102
Mass (Da):10,804
Checksum:i7D64A9733BB43204
GO
Isoform 4 (identifier: Q9BWK5-4) [UniParc]FASTAAdd to basket
Also known as: CYREN-21 Publication, MRI-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     47-69: LPATRTVYCMNEAEIVDVALGIL → CDSSGQKTPANLTPCDKDCVLHE
     70-157: Missing.

Show »
Length:69
Mass (Da):7,482
Checksum:i582A4325901CF300
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JKC7C9JKC7_HUMAN
Cell cycle regulator of non-homolog...
CYREN
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH00168 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03932082P → L in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs776124276Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0317671 – 55Missing in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0317681 – 45METLQ…PVAAA → MRLESLCHLCLACLFF in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_05852447 – 69LPATR…ALGIL → CDSSGQKTPANLTPCDKDCV LHE in isoform 4. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_05852570 – 157Missing in isoform 4. 1 PublicationAdd BLAST88

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK026103 mRNA No translation available.
AK130795 mRNA Translation: BAC85431.1
AC083862 Genomic DNA No translation available.
CH236950 Genomic DNA Translation: EAL24064.1
CH471070 Genomic DNA Translation: EAW83840.1
CH471070 Genomic DNA Translation: EAW83841.1
BC000168 mRNA Translation: AAH00168.1 Different initiation.
BC067350 mRNA Translation: AAH67350.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5838.2 [Q9BWK5-1]
CCDS59082.1 [Q9BWK5-3]
CCDS75663.1 [Q9BWK5-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001230678.1, NM_001243749.1 [Q9BWK5-4]
NP_001230680.1, NM_001243751.1 [Q9BWK5-4]
NP_001230681.1, NM_001243752.1 [Q9BWK5-4]
NP_001230682.1, NM_001243753.1 [Q9BWK5-4]
NP_001230683.1, NM_001243754.1 [Q9BWK5-3]
NP_001230684.1, NM_001243755.1 [Q9BWK5-3]
NP_001292558.1, NM_001305629.1
NP_076938.2, NM_024033.3 [Q9BWK5-1]
XP_016868078.1, XM_017012589.1
XP_016868079.1, XM_017012590.1
XP_016868080.1, XM_017012591.1 [Q9BWK5-1]
XP_016868082.1, XM_017012593.1 [Q9BWK5-3]
XP_016868083.1, XM_017012594.1 [Q9BWK5-3]
XP_016868084.1, XM_017012595.1 [Q9BWK5-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.643113
Hs.725212
Hs.732134
Hs.742852
Hs.744954

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000393114; ENSP00000376823; ENSG00000122783 [Q9BWK5-1]
ENST00000424142; ENSP00000400024; ENSG00000122783 [Q9BWK5-3]
ENST00000483029; ENSP00000473365; ENSG00000122783 [Q9BWK5-3]
ENST00000617987; ENSP00000480430; ENSG00000122783 [Q9BWK5-4]
ENST00000620897; ENSP00000481014; ENSG00000122783 [Q9BWK5-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
78996

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:78996

UCSC genome browser

More...
UCSCi
uc003vsl.4 human [Q9BWK5-1]
uc022amb.2 human

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026103 mRNA No translation available.
AK130795 mRNA Translation: BAC85431.1
AC083862 Genomic DNA No translation available.
CH236950 Genomic DNA Translation: EAL24064.1
CH471070 Genomic DNA Translation: EAW83840.1
CH471070 Genomic DNA Translation: EAW83841.1
BC000168 mRNA Translation: AAH00168.1 Different initiation.
BC067350 mRNA Translation: AAH67350.1
CCDSiCCDS5838.2 [Q9BWK5-1]
CCDS59082.1 [Q9BWK5-3]
CCDS75663.1 [Q9BWK5-4]
RefSeqiNP_001230678.1, NM_001243749.1 [Q9BWK5-4]
NP_001230680.1, NM_001243751.1 [Q9BWK5-4]
NP_001230681.1, NM_001243752.1 [Q9BWK5-4]
NP_001230682.1, NM_001243753.1 [Q9BWK5-4]
NP_001230683.1, NM_001243754.1 [Q9BWK5-3]
NP_001230684.1, NM_001243755.1 [Q9BWK5-3]
NP_001292558.1, NM_001305629.1
NP_076938.2, NM_024033.3 [Q9BWK5-1]
XP_016868078.1, XM_017012589.1
XP_016868079.1, XM_017012590.1
XP_016868080.1, XM_017012591.1 [Q9BWK5-1]
XP_016868082.1, XM_017012593.1 [Q9BWK5-3]
XP_016868083.1, XM_017012594.1 [Q9BWK5-3]
XP_016868084.1, XM_017012595.1 [Q9BWK5-4]
UniGeneiHs.643113
Hs.725212
Hs.732134
Hs.742852
Hs.744954

3D structure databases

ProteinModelPortaliQ9BWK5
SMRiQ9BWK5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122467, 1 interactor
IntActiQ9BWK5, 6 interactors
STRINGi9606.ENSP00000376823

PTM databases

iPTMnetiQ9BWK5
PhosphoSitePlusiQ9BWK5

Polymorphism and mutation databases

BioMutaiC7orf49
DMDMi182676205

Proteomic databases

EPDiQ9BWK5
jPOSTiQ9BWK5
MaxQBiQ9BWK5
PaxDbiQ9BWK5
PeptideAtlasiQ9BWK5
PRIDEiQ9BWK5
ProteomicsDBi79284
79285 [Q9BWK5-2]
79286 [Q9BWK5-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393114; ENSP00000376823; ENSG00000122783 [Q9BWK5-1]
ENST00000424142; ENSP00000400024; ENSG00000122783 [Q9BWK5-3]
ENST00000483029; ENSP00000473365; ENSG00000122783 [Q9BWK5-3]
ENST00000617987; ENSP00000480430; ENSG00000122783 [Q9BWK5-4]
ENST00000620897; ENSP00000481014; ENSG00000122783 [Q9BWK5-3]
GeneIDi78996
KEGGihsa:78996
UCSCiuc003vsl.4 human [Q9BWK5-1]
uc022amb.2 human

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
78996
DisGeNETi78996
EuPathDBiHostDB:ENSG00000122783.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CYREN

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0007109
HGNCiHGNC:22432 CYREN
HPAiHPA020060
MIMi616980 gene
neXtProtiNX_Q9BWK5
OpenTargetsiENSG00000122783
PharmGKBiPA162380533

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J164 Eukaryota
ENOG4111BHE LUCA
GeneTreeiENSGT00390000013192
HOGENOMiHOG000113652
HOVERGENiHBG108145
InParanoidiQ9BWK5
OMAiRTVYCMN
OrthoDBi1634776at2759
PhylomeDBiQ9BWK5
TreeFamiTF336925

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
C7orf49 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
78996

Protein Ontology

More...
PROi
PR:Q9BWK5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000122783 Expressed in 209 organ(s), highest expression level in gastrocnemius
ExpressionAtlasiQ9BWK5 baseline and differential
GenevisibleiQ9BWK5 HS

Family and domain databases

InterProiView protein in InterPro
IPR028278 MRI
PANTHERiPTHR14566 PTHR14566, 1 hit
PfamiView protein in Pfam
PF15325 MRI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCYREN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BWK5
Secondary accession number(s): A0A024R780
, A0A087WWQ8, Q6NWZ4, Q6ZNR5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: February 13, 2019
This is version 119 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again