Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 158 (16 Oct 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Enhancer of polycomb homolog 1

Gene

EPC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Chromatin regulator
Biological processGrowth regulation, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3214847 HATs acetylate histones
R-HSA-8953750 Transcriptional Regulation by E2F6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Enhancer of polycomb homolog 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EPC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19876 EPC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610999 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H2F5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
80314

Open Targets

More...
OpenTargetsi
ENSG00000120616

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134981141

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H2F5

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EPC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
59797889

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002141531 – 836Enhancer of polycomb homolog 1Add BLAST836

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki319Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei539PhosphoserineCombined sources1
Cross-linki673Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H2F5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H2F5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H2F5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H2F5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H2F5

PeptideAtlas

More...
PeptideAtlasi
Q9H2F5

PRoteomics IDEntifications database

More...
PRIDEi
Q9H2F5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
80540 [Q9H2F5-1]
80541 [Q9H2F5-2]
80542 [Q9H2F5-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H2F5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H2F5

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9H2F5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000120616 Expressed in 207 organ(s), highest expression level in secondary oocyte

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H2F5 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. HTATTIP/TIP60, EPC1, and ING3 together constitute a minimal HAT complex termed Piccolo NuA4.

Component of a NuA4-related complex which contains EP400, TRRAP/PAF400, SRCAP, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, actin, ACTL6A/BAF53A, VPS72 and YEATS4/GAS41. The NuA4 complex interacts with MYC and the adenovirus E1A protein. EPC1 interacts with TRIM27.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123227, 44 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-709 Piccolo NuA4 histone acetyltransferase complex
CPX-978 NuA4 histone acetyltransferase complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9H2F5

Protein interaction database and analysis system

More...
IntActi
Q9H2F5, 33 interactors

Molecular INTeraction database

More...
MINTi
Q9H2F5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000263062

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1836
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H2F5

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the enhancer of polycomb family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2261 Eukaryota
ENOG410XSSX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155003

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H2F5

KEGG Orthology (KO)

More...
KOi
K11322

Identification of Orthologs from Complete Genome Data

More...
OMAi
WSSPKEG

Database of Orthologous Groups

More...
OrthoDBi
957492at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H2F5

TreeFam database of animal gene trees

More...
TreeFami
TF106438

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024943 Enhancer_polycomb
IPR019542 Enhancer_polycomb-like_N
IPR009607 Enhancer_polycomb_C

The PANTHER Classification System

More...
PANTHERi
PTHR14898 PTHR14898, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06752 E_Pc_C, 1 hit
PF10513 EPL1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9H2F5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSKLSFRARA LDASKPLPVF RCEDLPDLHE YASINRAVPQ MPTGMEKEEE
60 70 80 90 100
SEHHLQRAIS AQQVYGEKRD NMVIPVPEAE SNIAYYESIY PGEFKMPKQL
110 120 130 140 150
IHIQPFSLDA EQPDYDLDSE DEVFVNKLKK KMDICPLQFE EMIDRLEKGS
160 170 180 190 200
GQQPVSLQEA KLLLKEDDEL IREVYEYWIK KRKNCRGPSL IPSVKQEKRD
210 220 230 240 250
GSSTNDPYVA FRRRTEKMQT RKNRKNDEAS YEKMLKLRRD LSRAVTILEM
260 270 280 290 300
IKRREKSKRE LLHLTLEIME KRYNLGDYNG EIMSEVMAQR QPMKPTYAIP
310 320 330 340 350
IIPITNSSQF KHQEAMDVKE FKVNKQDKAD LIRPKRKYEK KPKVLPSSAA
360 370 380 390 400
ATPQQTSPAA LPVFNAKDLN QYDFPSSDEE PLSQVLSGSS EAEEDNDPDG
410 420 430 440 450
PFAFRRKAGC QYYAPHLDQT GNWPWTSPKD GGLGDVRYRY CLTTLTVPQR
460 470 480 490 500
CIGFARRRVG RGGRVLLDRA HSDYDSVFHH LDLEMLSSPQ HSPVNQFANT
510 520 530 540 550
SETNTSDKSF SKDLSQILVN IKSCRWRHFR PRTPSLHDSD NDELSCRKLY
560 570 580 590 600
RSINRTGTAQ PGTQTCSTST QSKSSSGSAH FAFTAEQYQQ HQQQLALMQK
610 620 630 640 650
QQLAQIQQQQ ANSNSSTNTS QNLASNQQKS GFRLNIQGLE RTLQGFVSKT
660 670 680 690 700
LDSASAQFAA SALVTSEQLM GFKMKDDVVL GIGVNGVLPA SGVYKGLHLS
710 720 730 740 750
STTPTALVHT SPSTAGSALL QPSNITQTSS SHSALSHQVT AANSATTQVL
760 770 780 790 800
IGNNIRLTVP SSVATVNSIA PINARHIPRT LSAVPSSALK LAAAANCQVS
810 820 830
KVPSSSSVDS VPRENHESEK PALNNIADNT VAMEVT
Length:836
Mass (Da):93,463
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE9E89699E73336B5
GO
Isoform 2 (identifier: Q9H2F5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-643: Missing.

Show »
Length:813
Mass (Da):90,865
Checksum:iAD6AE9D14C3020A7
GO
Isoform 3 (identifier: Q9H2F5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEES → M
     621-643: Missing.

Show »
Length:763
Mass (Da):85,222
Checksum:i9AAF6D3B2C0E3840
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB14888 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC03857 differs from that shown. Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti156S → G in AAK60501 (Ref. 2) Curated1
Sequence conflicti256K → R in AAK60501 (Ref. 2) Curated1
Sequence conflicti783A → V in AAH36529 (PubMed:15489334).Curated1
Sequence conflicti825N → S in BAC03857 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_074181123V → L1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0128751 – 51MSKLS…KEEES → M in isoform 3. 2 PublicationsAdd BLAST51
Alternative sequenceiVSP_012877621 – 643Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF277374 mRNA Translation: AAG41402.1
AF286905 mRNA Translation: AAK60501.1
AK024329 mRNA Translation: BAB14888.1 Different initiation.
AK092304 mRNA Translation: BAC03857.1 Sequence problems.
AK299676 mRNA Translation: BAG61585.1
AL158834 Genomic DNA No translation available.
AL391839 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85972.1
CH471072 Genomic DNA Translation: EAW85973.1
BC036529 mRNA Translation: AAH36529.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS60511.1 [Q9H2F5-2]
CCDS7172.1 [Q9H2F5-1]
CCDS73083.1 [Q9H2F5-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001258933.1, NM_001272004.1 [Q9H2F5-2]
NP_001258948.1, NM_001272019.2
NP_001269320.1, NM_001282391.1 [Q9H2F5-3]
NP_079485.1, NM_025209.3 [Q9H2F5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263062; ENSP00000263062; ENSG00000120616 [Q9H2F5-1]
ENST00000319778; ENSP00000318559; ENSG00000120616 [Q9H2F5-2]
ENST00000375110; ENSP00000364251; ENSG00000120616 [Q9H2F5-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80314

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80314

UCSC genome browser

More...
UCSCi
uc001iwg.3 human [Q9H2F5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF277374 mRNA Translation: AAG41402.1
AF286905 mRNA Translation: AAK60501.1
AK024329 mRNA Translation: BAB14888.1 Different initiation.
AK092304 mRNA Translation: BAC03857.1 Sequence problems.
AK299676 mRNA Translation: BAG61585.1
AL158834 Genomic DNA No translation available.
AL391839 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85972.1
CH471072 Genomic DNA Translation: EAW85973.1
BC036529 mRNA Translation: AAH36529.1
CCDSiCCDS60511.1 [Q9H2F5-2]
CCDS7172.1 [Q9H2F5-1]
CCDS73083.1 [Q9H2F5-3]
RefSeqiNP_001258933.1, NM_001272004.1 [Q9H2F5-2]
NP_001258948.1, NM_001272019.2
NP_001269320.1, NM_001282391.1 [Q9H2F5-3]
NP_079485.1, NM_025209.3 [Q9H2F5-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6NFXX-ray1.95A644-671[»]
SMRiQ9H2F5
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi123227, 44 interactors
ComplexPortaliCPX-709 Piccolo NuA4 histone acetyltransferase complex
CPX-978 NuA4 histone acetyltransferase complex
CORUMiQ9H2F5
IntActiQ9H2F5, 33 interactors
MINTiQ9H2F5
STRINGi9606.ENSP00000263062

PTM databases

iPTMnetiQ9H2F5
PhosphoSitePlusiQ9H2F5
SwissPalmiQ9H2F5

Polymorphism and mutation databases

BioMutaiEPC1
DMDMi59797889

Proteomic databases

EPDiQ9H2F5
jPOSTiQ9H2F5
MassIVEiQ9H2F5
MaxQBiQ9H2F5
PaxDbiQ9H2F5
PeptideAtlasiQ9H2F5
PRIDEiQ9H2F5
ProteomicsDBi80540 [Q9H2F5-1]
80541 [Q9H2F5-2]
80542 [Q9H2F5-3]

Genome annotation databases

EnsembliENST00000263062; ENSP00000263062; ENSG00000120616 [Q9H2F5-1]
ENST00000319778; ENSP00000318559; ENSG00000120616 [Q9H2F5-2]
ENST00000375110; ENSP00000364251; ENSG00000120616 [Q9H2F5-3]
GeneIDi80314
KEGGihsa:80314
UCSCiuc001iwg.3 human [Q9H2F5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80314
DisGeNETi80314

GeneCards: human genes, protein and diseases

More...
GeneCardsi
EPC1
HGNCiHGNC:19876 EPC1
MIMi610999 gene
neXtProtiNX_Q9H2F5
OpenTargetsiENSG00000120616
PharmGKBiPA134981141

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2261 Eukaryota
ENOG410XSSX LUCA
GeneTreeiENSGT00940000155003
InParanoidiQ9H2F5
KOiK11322
OMAiWSSPKEG
OrthoDBi957492at2759
PhylomeDBiQ9H2F5
TreeFamiTF106438

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones
R-HSA-8953750 Transcriptional Regulation by E2F6

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
EPC1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
EPC1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80314
PharosiQ9H2F5

Protein Ontology

More...
PROi
PR:Q9H2F5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000120616 Expressed in 207 organ(s), highest expression level in secondary oocyte
GenevisibleiQ9H2F5 HS

Family and domain databases

InterProiView protein in InterPro
IPR024943 Enhancer_polycomb
IPR019542 Enhancer_polycomb-like_N
IPR009607 Enhancer_polycomb_C
PANTHERiPTHR14898 PTHR14898, 1 hit
PfamiView protein in Pfam
PF06752 E_Pc_C, 1 hit
PF10513 EPL1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEPC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H2F5
Secondary accession number(s): B4DSC3
, D3DRX7, Q5VW54, Q5VW56, Q5VW58, Q8NAQ4, Q8NE21, Q96LF4, Q96RR6, Q9H7T7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: March 1, 2001
Last modified: October 16, 2019
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again