Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 153 (13 Nov 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sodium-dependent neutral amino acid transporter B(0)AT2

Gene

SLC6A15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent.1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.16 mM for L-leucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  2. KM=0.16 mM for L-valine (at pH 7.5, 100 mM NaCL, -70 mV))1 Publication
  3. KM=0.08 mM for L-isoleucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  4. KM=0.11 mM for L-methionine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  5. KM=0.38 mM for L-proline (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication

    pH dependencei

    Optimum pH is 7.5-8.5. Strongly inhibited at acidic PH.1 Publication

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Biological processAmino-acid transport, Ion transport, Neurotransmitter transport, Sodium transport, Symport, Transport
    LigandSodium

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-352230 Amino acid transport across the plasma membrane
    R-HSA-442660 Na+/Cl- dependent neurotransmitter transporters

    Protein family/group databases

    Transport Classification Database

    More...
    TCDBi
    2.A.22.6.7 the neurotransmitter:sodium symporter (nss) family

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Sodium-dependent neutral amino acid transporter B(0)AT2
    Alternative name(s):
    Sodium- and chloride-dependent neurotransmitter transporter NTT73
    Sodium-coupled branched-chain amino-acid transporter 1
    Solute carrier family 6 member 15
    Transporter v7-3
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:SLC6A15
    Synonyms:B0AT2, NTT73, SBAT1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:13621 SLC6A15

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    607971 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9H2J7

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 69CytoplasmicSequence analysisAdd BLAST69
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei70 – 90Helical; Name=1Sequence analysisAdd BLAST21
    Transmembranei98 – 117Helical; Name=2Sequence analysisAdd BLAST20
    Transmembranei142 – 162Helical; Name=3Sequence analysisAdd BLAST21
    Topological domaini163 – 225ExtracellularSequence analysisAdd BLAST63
    Transmembranei226 – 244Helical; Name=4Sequence analysisAdd BLAST19
    Transmembranei253 – 270Helical; Name=5Sequence analysisAdd BLAST18
    Transmembranei306 – 323Helical; Name=6Sequence analysisAdd BLAST18
    Transmembranei335 – 356Helical; Name=7Sequence analysisAdd BLAST22
    Topological domaini357 – 452ExtracellularSequence analysisAdd BLAST96
    Transmembranei453 – 472Helical; Name=8Sequence analysisAdd BLAST20
    Transmembranei496 – 514Helical; Name=9Sequence analysisAdd BLAST19
    Transmembranei530 – 550Helical; Name=10Sequence analysisAdd BLAST21
    Transmembranei571 – 592Helical; Name=11Sequence analysisAdd BLAST22
    Transmembranei620 – 642Helical; Name=12Sequence analysisAdd BLAST23
    Topological domaini643 – 730CytoplasmicSequence analysisAdd BLAST88

    Keywords - Cellular componenti

    Membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    55117

    Open Targets

    More...
    OpenTargetsi
    ENSG00000072041

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA37799

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q9H2J7

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL3351189

    DrugCentral

    More...
    DrugCentrali
    Q9H2J7

    IUPHAR/BPS Guide to PHARMACOLOGY

    More...
    GuidetoPHARMACOLOGYi
    940

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    SLC6A15

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    18202939

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002147981 – 730Sodium-dependent neutral amino acid transporter B(0)AT2Add BLAST730

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei25PhosphoserineCombined sources1
    Modified residuei55PhosphoserineCombined sources1
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi187N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi213N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi383N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi394N-linked (GlcNAc...) asparagineSequence analysis1
    Modified residuei687PhosphoserineCombined sources1
    Modified residuei699PhosphoserineCombined sources1
    Modified residuei701PhosphoserineCombined sources1

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9H2J7

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q9H2J7

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q9H2J7

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q9H2J7

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9H2J7

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9H2J7

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9H2J7

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    6449
    80556 [Q9H2J7-1]
    80557 [Q9H2J7-2]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9H2J7

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9H2J7

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Almost exclusively expressed in the brain.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000072041 Expressed in 128 organ(s), highest expression level in corpus callosum

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9H2J7 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9H2J7 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA008609

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    120426, 40 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q9H2J7, 34 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000266682

    Chemistry databases

    BindingDB database of measured binding affinities

    More...
    BindingDBi
    Q9H2J7

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG3659 Eukaryota
    COG0733 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000157277

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000116406

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9H2J7

    KEGG Orthology (KO)

    More...
    KOi
    K05048

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    MIPHHIN

    Database of Orthologous Groups

    More...
    OrthoDBi
    1222373at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9H2J7

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF352709

    Family and domain databases

    Conserved Domains Database

    More...
    CDDi
    cd11522 SLC6sbd_SBAT1, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR042934 B(0)AT2
    IPR000175 Na/ntran_symport
    IPR002438 Neutral_aa_SLC6
    IPR037272 SNS_sf

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR11616 PTHR11616, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF00209 SNF, 1 hit

    Protein Motif fingerprint database; a protein domain database

    More...
    PRINTSi
    PR00176 NANEUSMPORT
    PR01206 ORPHTRNSPORT

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF161070 SSF161070, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS00610 NA_NEUROTRAN_SYMP_1, 1 hit
    PS00754 NA_NEUROTRAN_SYMP_2, 1 hit
    PS50267 NA_NEUROTRAN_SYMP_3, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9H2J7-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MPKNSKVVKR ELDDDVTESV KDLLSNEDAA DDAFKTSELI VDGQEEKDTD
    60 70 80 90 100
    VEEGSEVEDE RPAWNSKLQY ILAQVGFSVG LGNVWRFPYL CQKNGGGAYL
    110 120 130 140 150
    LPYLILLMVI GIPLFFLELS VGQRIRRGSI GVWNYISPKL GGIGFASCVV
    160 170 180 190 200
    CYFVALYYNV IIGWSLFYFS QSFQQPLPWD QCPLVKNASH TFVEPECEQS
    210 220 230 240 250
    SATTYYWYRE ALNISSSISE SGGLNWKMTI CLLAAWVMVC LAMIKGIQSS
    260 270 280 290 300
    GKIIYFSSLF PYVVLICFLI RAFLLNGSID GIRHMFTPKL EIMLEPKVWR
    310 320 330 340 350
    EAATQVFFAL GLGFGGVIAF SSYNKRDNNC HFDAVLVSFI NFFTSVLATL
    360 370 380 390 400
    VVFAVLGFKA NVINEKCITQ NSETIMKFLK MGNISQDIIP HHINLSTVTA
    410 420 430 440 450
    EDYHLVYDII QKVKEEEFPA LHLNSCKIEE ELNKAVQGTG LAFIAFTEAM
    460 470 480 490 500
    THFPASPFWS VMFFLMLVNL GLGSMFGTIE GIVTPIVDTF KVRKEILTVI
    510 520 530 540 550
    CCLLAFCIGL IFVQRSGNYF VTMFDDYSAT LPLLIVVILE NIAVCFVYGI
    560 570 580 590 600
    DKFMEDLKDM LGFAPSRYYY YMWKYISPLM LLSLLIASVV NMGLSPPGYN
    610 620 630 640 650
    AWIEDKASEE FLSYPTWGLV VCVSLVVFAI LPVPVVFIVR RFNLIDDSSG
    660 670 680 690 700
    NLASVTYKRG RVLKEPVNLE GDDTSLIHGK IPSEMPSPNF GKNIYRKQSG
    710 720 730
    SPTLDTAPNG RYGIGYLMAD IMPDMPESDL
    Length:730
    Mass (Da):81,836
    Last modified:March 1, 2001 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i45963118E06CFFE6
    GO
    Isoform 2 (identifier: Q9H2J7-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         253-289: IIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPK → VSMLEPFLILLITISGFIPLSNSVTDFCGQITHNTSF
         290-730: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:289
    Mass (Da):32,264
    Checksum:iAB0768CD8F74BF47
    GO
    Isoform 3 (identifier: Q9H2J7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-107: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:623
    Mass (Da):69,886
    Checksum:iDB10A517144B0643
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    F8WJN6F8WJN6_HUMAN
    Sodium-dependent neutral amino acid...
    SLC6A15
    316Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8VX16F8VX16_HUMAN
    Sodium-dependent neutral amino acid...
    SLC6A15
    71Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8VSG1F8VSG1_HUMAN
    Sodium-dependent neutral amino acid...
    SLC6A15
    96Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    S4R439S4R439_HUMAN
    Sodium-dependent neutral amino acid...
    SLC6A15
    19Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052065400A → V1 PublicationCorresponds to variant dbSNP:rs12424429Ensembl.1
    Natural variantiVAR_052066603I → M. Corresponds to variant dbSNP:rs3782369Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451921 – 107Missing in isoform 3. 1 PublicationAdd BLAST107
    Alternative sequenceiVSP_043030253 – 289IIYFS…MFTPK → VSMLEPFLILLITISGFIPL SNSVTDFCGQITHNTSF in isoform 2. 1 PublicationAdd BLAST37
    Alternative sequenceiVSP_043031290 – 730Missing in isoform 2. 1 PublicationAdd BLAST441

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AF265577 mRNA Translation: AAG41361.1
    AK022853 mRNA Translation: BAB14274.1
    AK291207 mRNA Translation: BAF83896.1
    AK294945 mRNA Translation: BAH11933.1
    AC018922 Genomic DNA No translation available.
    AC128657 Genomic DNA No translation available.
    CH471054 Genomic DNA Translation: EAW97389.1
    BC070040 mRNA Translation: AAH70040.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS53816.1 [Q9H2J7-3]
    CCDS9026.1 [Q9H2J7-1]
    CCDS9027.1 [Q9H2J7-2]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001139807.1, NM_001146335.2 [Q9H2J7-3]
    NP_060527.2, NM_018057.6 [Q9H2J7-2]
    NP_877499.1, NM_182767.5 [Q9H2J7-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000266682; ENSP00000266682; ENSG00000072041 [Q9H2J7-1]
    ENST00000450363; ENSP00000390706; ENSG00000072041 [Q9H2J7-2]
    ENST00000552192; ENSP00000450145; ENSG00000072041 [Q9H2J7-3]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    55117

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:55117

    UCSC genome browser

    More...
    UCSCi
    uc001szv.5 human [Q9H2J7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF265577 mRNA Translation: AAG41361.1
    AK022853 mRNA Translation: BAB14274.1
    AK291207 mRNA Translation: BAF83896.1
    AK294945 mRNA Translation: BAH11933.1
    AC018922 Genomic DNA No translation available.
    AC128657 Genomic DNA No translation available.
    CH471054 Genomic DNA Translation: EAW97389.1
    BC070040 mRNA Translation: AAH70040.1
    CCDSiCCDS53816.1 [Q9H2J7-3]
    CCDS9026.1 [Q9H2J7-1]
    CCDS9027.1 [Q9H2J7-2]
    RefSeqiNP_001139807.1, NM_001146335.2 [Q9H2J7-3]
    NP_060527.2, NM_018057.6 [Q9H2J7-2]
    NP_877499.1, NM_182767.5 [Q9H2J7-1]

    3D structure databases

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    SWISS-MODEL Interactive Workspace

    More...
    SWISS-MODEL-Workspacei
    Submit a new modelling project...

    Protein-protein interaction databases

    BioGridi120426, 40 interactors
    IntActiQ9H2J7, 34 interactors
    STRINGi9606.ENSP00000266682

    Chemistry databases

    BindingDBiQ9H2J7
    ChEMBLiCHEMBL3351189
    DrugCentraliQ9H2J7
    GuidetoPHARMACOLOGYi940

    Protein family/group databases

    TCDBi2.A.22.6.7 the neurotransmitter:sodium symporter (nss) family

    PTM databases

    iPTMnetiQ9H2J7
    PhosphoSitePlusiQ9H2J7

    Polymorphism and mutation databases

    BioMutaiSLC6A15
    DMDMi18202939

    Proteomic databases

    EPDiQ9H2J7
    jPOSTiQ9H2J7
    MassIVEiQ9H2J7
    MaxQBiQ9H2J7
    PaxDbiQ9H2J7
    PeptideAtlasiQ9H2J7
    PRIDEiQ9H2J7
    ProteomicsDBi6449
    80556 [Q9H2J7-1]
    80557 [Q9H2J7-2]

    Genome annotation databases

    EnsembliENST00000266682; ENSP00000266682; ENSG00000072041 [Q9H2J7-1]
    ENST00000450363; ENSP00000390706; ENSG00000072041 [Q9H2J7-2]
    ENST00000552192; ENSP00000450145; ENSG00000072041 [Q9H2J7-3]
    GeneIDi55117
    KEGGihsa:55117
    UCSCiuc001szv.5 human [Q9H2J7-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    55117
    DisGeNETi55117

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    SLC6A15
    HGNCiHGNC:13621 SLC6A15
    HPAiHPA008609
    MIMi607971 gene
    neXtProtiNX_Q9H2J7
    OpenTargetsiENSG00000072041
    PharmGKBiPA37799

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG3659 Eukaryota
    COG0733 LUCA
    GeneTreeiENSGT00940000157277
    HOGENOMiHOG000116406
    InParanoidiQ9H2J7
    KOiK05048
    OMAiMIPHHIN
    OrthoDBi1222373at2759
    PhylomeDBiQ9H2J7
    TreeFamiTF352709

    Enzyme and pathway databases

    ReactomeiR-HSA-352230 Amino acid transport across the plasma membrane
    R-HSA-442660 Na+/Cl- dependent neurotransmitter transporters

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    SLC6A15 human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    SLC6A15

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    55117
    PharosiQ9H2J7

    Protein Ontology

    More...
    PROi
    PR:Q9H2J7

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000072041 Expressed in 128 organ(s), highest expression level in corpus callosum
    ExpressionAtlasiQ9H2J7 baseline and differential
    GenevisibleiQ9H2J7 HS

    Family and domain databases

    CDDicd11522 SLC6sbd_SBAT1, 1 hit
    InterProiView protein in InterPro
    IPR042934 B(0)AT2
    IPR000175 Na/ntran_symport
    IPR002438 Neutral_aa_SLC6
    IPR037272 SNS_sf
    PANTHERiPTHR11616 PTHR11616, 1 hit
    PfamiView protein in Pfam
    PF00209 SNF, 1 hit
    PRINTSiPR00176 NANEUSMPORT
    PR01206 ORPHTRNSPORT
    SUPFAMiSSF161070 SSF161070, 1 hit
    PROSITEiView protein in PROSITE
    PS00610 NA_NEUROTRAN_SYMP_1, 1 hit
    PS00754 NA_NEUROTRAN_SYMP_2, 1 hit
    PS50267 NA_NEUROTRAN_SYMP_3, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS6A15_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H2J7
    Secondary accession number(s): A8K592
    , B7Z2P7, E7ESJ5, Q9H9F5
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: March 1, 2001
    Last modified: November 13, 2019
    This is version 153 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. SIMILARITY comments
      Index of protein domains and families
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again